KEGG   Canis lupus familiaris (dog): 474528
Entry
474528            CDS       T01007                                 

Gene name
CRY1
Definition
(RefSeq) cryptochrome-1
  KO
K02295  cryptochrome
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    474528 (CRY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfa03400]
    474528 (CRY1)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    474528 (CRY1)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6
Other DBs
NCBI-GeneID: 474528
NCBI-ProteinID: XP_005625992
Ensembl: ENSCAFG00000001797
VGNC: 39633
UniProt: E2RMX4
Position
10
AA seq 587 aa
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVVEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLPSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLMGYSPGENIPGCSSSGSCSQGSGILHY
AHGDSQQTHLLKQGRSSMGTGLSSGKRPSEEEDTQTISPKVQRQSTN
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgggggtgaacgccgtgcactggttccgaaaggggctccggcttcacgacaaccccgcc
ctgaaggagtgcatccagggcgccgacaccatccgctgcgtctacatcctcgacccctgg
ttcgccggctcctccaatgtgggcatcaacaggtggcgatttttgcttcaatgtcttgaa
gaccttgatgccaatctgcgaaagttaaactctcgtctgtttgtgattcgtggacagcca
gcagatgtgtttcccaggctttttaaggaatggaacattactaaactttcaattgagtat
gattctgagccctttggaaaggaacgagatgcagctattaagaaactggctactgaagct
ggagtagaagtaattgtacgaatttcacatacattatatgacctggacaagatcatcgaa
ctcaatggtggacaaccacctcttacatataaaagattccagactctcatcagcaaaatg
gaaccactagagataccagtagagacaattacttcagaagtagtagaaaagtgcacaact
cctctgtctgatgaccatgatgagaaatatggggtcccttcactggaagaactaggtttt
gatacagatggtttgccctctgcagtatggccaggcggagaaactgaagcacttacacgt
ttggaaaggcatttggaaagaaaagcttgggtggcaaactttgaaagacctcgaatgaat
gcaaattccctgctcgctagccctactggactcagtccttatctccgatttggttgtttg
tcatgtcgactattttacttcaaactcacagatctctacaaaaaggtgaagaagaatagt
tcccctcccctttccctttatgggcaactgttatggcgtgaatttttctatacagcagca
acaaataatccacgctttgataaaatggaaggaaaccccatctgtgttcagattccttgg
gataaaaatcccgaggctttagcaaaatgggcagaaggccggacaggctttccatggatt
gatgccatcatgacacagcttcgtcaggagggttggattcaccatttagccagacatgca
gtagcttgcttcctgacccgaggtgacctgtggattagttgggaagaaggaatgaaggta
tttgaagaattattgcttgatgcagattggagcataaatgctggaagttggatgtggctg
tcttgtagttcctttttccaacagttttttcactgctattgccctgttggttttggtagg
agaacagatcccaatggagactatatcaggcgttatttgcctgtcctaagaggtttccct
gcaaaatatatctatgatccctggaatgcaccagaaggtatccaaaaggtagccaaatgt
ttgataggagttaattatcctaaaccaatggtgaatcatgctgaggcaagccgtttgaat
attgagaggatgaagcagatctaccagcagctttcacgatatagaggactgggtcttctt
gcatcagtgccttctaatcctaatgggaatggaggcctcatggggtattctcctggagaa
aatattccaggttgtagcagcagtggaagttgctctcaagggagtggtattttacactat
gctcatggagacagtcagcaaactcacctattaaagcaaggaagaagctccatgggcact
ggtctcagcagtgggaaacgtcctagtgaggaagaggacacacagactatcagtcctaaa
gtccagcgacagagcactaattag

DBGET integrated database retrieval system