KEGG   Canis lupus familiaris (dog): 474599
Entry
474599            CDS       T01007                                 

Gene name
RPS27A
Definition
(RefSeq) ubiquitin-40S ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03010  Ribosome
cfa04120  Ubiquitin mediated proteolysis
cfa04137  Mitophagy - animal
cfa05012  Parkinson disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    474599 (RPS27A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    474599 (RPS27A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    474599 (RPS27A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    474599 (RPS27A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    474599 (RPS27A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    474599 (RPS27A)
   05022 Pathways of neurodegeneration - multiple diseases
    474599 (RPS27A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cfa03011]
    474599 (RPS27A)
   04121 Ubiquitin system [BR:cfa04121]
    474599 (RPS27A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    474599 (RPS27A)
Ribosome [BR:cfa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    474599 (RPS27A)
  Archaea
    474599 (RPS27A)
Ubiquitin system [BR:cfa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   474599 (RPS27A)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474599 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   474599 (RPS27A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD DUF2407 Ubiquitin_5
Other DBs
NCBI-GeneID: 474599
NCBI-ProteinID: NP_001239157
Ensembl: ENSCAFG00000023471
UniProt: F1PEZ4
Position
10
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagattttcgtgaagacccttacggggaagaccatcactctcgaggttgagccctcg
gatacaatagaaaatgtaaaggccaagattcaggataaggaaggaatccctcctgatcag
cagagactgatatttgctggcaagcaactggaggatggccgtactttgtctgactacaac
attcaaaaggagtccactcttcatcttgtgttgagacttcgtggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaataagcataagagaaagaaggttaagctg
gctgtcctgaaatactacaaggtggacgagaatggcaaaatcagtcgccttcgtcgagag
tgcccttcagatgaatgtggtgctggagtttttatggctagccacttcgacagacattat
tgtggcaaatgttgtctgacctattgcttcaacaaaccagaagacaagtaa

DBGET integrated database retrieval system