KEGG   Canis familiaris (dog): 474629
Entry
474629            CDS       T01007                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    474629 (ANKRD53)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    474629 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 474629
NCBI-ProteinID: XP_005626255
Ensembl: ENSCAFG00000003461
VGNC: 37909
UniProt: F1PF18
Position
10
AA seq 507 aa
MQSAEKVSSRVLLSDSASKQPRAGRPDSNAACLPASPLPALHSCALTRPDDAWVQSAIGG
YYELFAAALGNLEWLHFCLSRDRKEIPADDKGFTAIHFAAQSGKLACLQVLVEEYNFPVD
LPTNNGQTPLHLVIHGDNKTMTLPCIHYLLKQGAALNTHMAFVLPFLFPAGVALYSQTCN
GSTPLHMAAFQGLLSCVKVLVQNGADVHARDATGCKPIDYCKIWNHRDCARFLKDAMWRR
DKKDFACETKKLKRLKDQLIFMEQDYLTEYQKEHQILREADFKEWLRCKQLLRGQSLIRN
AKPGPGAPPEAITVSKTPKHKGPPKSFYPSPEARLRQTPALQLQPVGTPTPTYTKPTVRR
PKSWNVSNNPARSPTAQIGYPQGIRLGVHPDPSPDHDFRSFLEVRPDEHSGAQLCTVAGS
RVAPVPQLPFEVMVQELYPSARPYRMRAPQGFHSVSMRDVPQKRHLGDNFWTDTLAMNLR
ETFDEAFLAALRAHQGLPTLPSLKSPP
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgcagtcagcggagaaggtctcctccagagtcctcctgagtgactcagcgtccaagcag
cccagggcgggccgcccagactccaacgctgcttgcctgcctgcctccccactccccgcc
ctccactcttgcgccctcactcgcccggacgacgcatgggtccagagtgccattgggggc
tactatgagttgtttgccgctgcactgggcaacctggaatggttgcacttctgtctgagt
cgggaccgtaaggaaattccagccgatgacaagggcttcactgccatccactttgcagcc
cagagtggcaagcttgcgtgcctgcaggtcttggtagaggagtacaattttcctgtggac
ctgcccaccaacaatggccagacacccctgcacctggtcatccacggggacaacaagacc
atgaccctcccctgcattcactatctgcttaagcaaggggcggccctcaacacgcacatg
gcctttgtccttcctttcctcttcccggctggtgtggccctctacagtcagacatgcaat
ggctctactcccctccacatggcagccttccaaggcctgctgagctgtgtgaaggtgctg
gtgcaaaatggtgccgatgtccatgcccgagatgccacaggctgcaagcccatcgactac
tgcaaaatatggaaccaccgcgactgtgcccggttcttgaaggatgcgatgtggagacgg
gacaagaaggactttgcttgtgagacgaagaaactgaagaggctcaaggaccagctgatc
ttcatggaacaggactacctgactgaatatcagaaagagcaccaaattctgagagaagcc
gatttcaaggagtggctccgttgcaagcagctgctccgaggccagtccctgatccgcaat
gccaagccagggcctggtgccccacccgaggcgatcaccgtgtccaagacccccaagcac
aaggggccccccaagagcttctacccctccccggaggcacgcctgaggcagacaccagcg
ctacagctgcagcccgtggggacacccacacccacgtacacgaagcccacggtcaggcgg
cccaagtcgtggaatgtgagcaacaacccagccagatcacccaccgcccagattggctac
ccacagggcatccgcctgggcgtgcacccagaccccagcccggatcacgacttccgcagc
ttcctcgaggtgaggcctgatgagcacagtggggcacaactgtgcacggtggccggcagc
cgggtggcacctgtgccccagctgcccttcgaggtgatggtgcaagagctgtacccttca
gcgcggccgtacaggatgagagcgccccagggctttcactccgtcagcatgagggacgtg
ccccagaagcggcacttgggtgacaacttctggactgacactctggccatgaacctgcgc
gagacatttgatgaagccttcctggcagctctgcgagcccatcaagggctccccactctg
ccctccctcaaaagccccccataa

DBGET integrated database retrieval system