KEGG   Canis lupus familiaris (dog): 474708
Entry
474708            CDS       T01007                                 
Symbol
MPDZ
Name
(RefSeq) multiple PDZ domain protein isoform X1
  KO
K06095  multiple PDZ domain protein
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    474708 (MPDZ)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 L27_2 MPDZ_u10 L27_1
Other DBs
NCBI-GeneID: 474708
NCBI-ProteinID: XP_038514592
Ensembl: ENSCAFG00000001498
VGNC: 43332
Position
11:complement(32400323..32561595)
AA seq 2123 aa
MLETIDKNRALQAAERLQAKLRERGDVANEDKLNLLKSVLQSSLFSQILNLQTSVQRLKD
QVNTTTSVISNVEYAHIPHTSPAVIPTLQNELFLSSNNGNLEAFTGSGTLHINGKPACDE
FDQLIKNMAQGRHVEVFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGR
LKETDQILAINGQALDQTITHQQAISILQKAKDNVQLVIARGSLPQLISPIVSRSPSAAS
TISAHSNPIHWQHVETIELVNDGSGLGFGIVGGKATGVIVKTILPGGVADQHGRLCSGDH
ILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEEPAAPNSLGITLSSSPSSIPEM
QVDASTQKSEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGR
IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGPTVHLTLMRRGVKQEAELTSREDVTKDMV
LSPLNASGNKGGICSAFTVYASLPFLNVQPFLAENYEKDEDSSSLSRNTSILPIEEEGKH
LEPGYPLLSAEIEDIEDAQQQEAALLTRWQRIMGINYEIVVAHVSKFSENSGLGISLEAT
VGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCR
RTVPPTSQSGLDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDVSQNAEEVQGPLA
MWEVDVQHIELEKGNKGLGFSILDYQDPIDPTSTVIVIRSLVPGGIAEKDGRLLPGDRLM
FVNDVNLENSSLEEAVQALKGAPSGTVRIGVAKPLPLSPEEGYVSAKEDSFLHPRHSCEE
EGPADRALFRADLALVDTNEADLADESTFESQYSPDNDSIYSTQASILSLHGSACSDGLN
YGPSLPSSPPKDVTENSSDPVLDLHMSLEELYTQNLLQRQDESPSSVDLSMAPASGFTVN
DYTPANAIEQQYKCENTRTWAESHLPNEIISSAELTSPVLPDSTGKGSEFLIQQSSLTST
GECVMLQNLSKEMFERTITIAKGNSSLGMTVSANKDGLGMIVRSIIHGGSISRDGRIAVG
DCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQPGGVMAL
DVLSSYTGRDIPELPEREEGEGEESELQNAAYSNWNQPRRVELWREPSKSLGISIVGGRG
MGSRLSNGEVMRGIFIKHVLDDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKA
GNPVVFMVQSIINRPRKSPLPSLPHNLYPKYNFSSTNPFADSLQFNADKELQNSSRVTFR
CSPTNPFAPTPFKAPSQSESEPEKAPLSTVPPPPSSAFAEMSSDHTQSSASKISEDVDKE
DEFGYSWKNVRERYGTLTGELHMIELEKGRSGLGLSLAGNKDRSRMSVFVVGIDPNGAAG
KDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVSQMAVCPGNTV
EPLPSASENSQNKEAEPTGTTSDAAVDLCSFKNVQHLELPKDQGGLGIAITEEDTLSGVV
IKSLTEHGVAAKDGRLKVGDQILAVDDEVVVGYPVEKFISLLKTAKTTVKLSIRAENRDP
QAVASAAGAASGEQKSSSLALMAPSSGSPEPESIPSTSRSSTPAIFASDPATCPIIPGCE
TTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRK
ATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVYDTLTIELQKKPGKGLGLSIVGKRNDT
GVFVSDIVKGGIADADGRLVQGDQILTVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIK
AGPFHSERRPSQSSQMSEGSLSSFTFPLSGSSTSESLESSLKKNALASEIQGLRTVEIKK
GPADSLGISIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTEGMTHT
QAVNLLKNAPGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTALTSSSIFQDDLGPPQCKS
ITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEG
VTHEEAVAILKRTKGTVTLMVLS
NT seq 6372 nt   +upstreamnt  +downstreamnt
atgttagaaactatagacaaaaatcgagccctgcaggcagcagaacgcttgcaagccaag
ctgcgagaacgtggagatgtagcaaatgaagacaaactgaatcttctgaagtcagtcttg
cagagctcactcttcagtcagatcctaaaccttcagacttccgtacagcggctgaaagac
caggtaaacactacaacatcagtgatttcaaatgttgaatatgcccacattccacatacc
agccctgctgtaattcctaccctgcaaaatgaattattcttatcctcaaataatgggaat
ctggaagcatttacaggatctggtactctacatatcaatgggaaacctgcttgtgatgaa
tttgatcaactaatcaaaaatatggcccagggtcgccatgtggaagtttttgagctcctt
aaacctccatgtggaggccttgggtttagtgttgtgggactaaggagtgaaaaccgggga
gaactgggaatatttgtgcaagagatccaagagggcagtgtggctcacagagatggaaga
ttgaaggaaactgatcagatccttgctatcaatggacaggcacttgatcagacaatcaca
catcagcaggctatcagcatcctgcagaaagccaaggataacgttcagctagttattgcc
agaggctcattgcctcaactcatcagccccatagtttcccgttctccatctgcagccagt
acaatttcagctcactctaacccgattcactggcagcatgtggagactattgaactggtg
aatgatggatctggactgggatttggcatcgttggaggaaaagcaactggtgtgatagta
aaaaccattttgcctggaggagtggctgaccagcatgggcgattatgcagtggagaccac
attctaaagataggtgacacggatctagcaggaatgagcagtgagcaagtagcacaggtg
ctcaggcagtgtggaaatagagttaaactgatgatcgcaagaggtgccatagaagaacca
gcagcacccaattctttgggcatcaccctttcctcatccccatcttctataccagaaatg
caggttgatgcttctactcagaaaagtgaagaaagtgagacttttgatgtagaactcact
aaaaatgtccaaggattaggaattaccattgctggttacattggagataaaaaattagaa
ccttcaggaatctttgtaaagagcattacaaagagcagtgctgttgaacatgatggaaga
atccaaattggagaccaaattatagcagtggatggcacaaaccttcagggttttaccaat
cagcaagcagtagaggtgttgcgacacacaggaccaactgtgcacctgacactaatgaga
agaggagtgaagcaggaggctgagctcacgtcaagggaggatgtcacaaaggacatggtt
ttgtctcctttgaatgccagcggaaacaaagggggaatctgttctgcctttactgtgtat
gcaagcctcccatttctaaatgtccagcctttccttgcagaaaattatgaaaaagatgaa
gattcttcatctttgagtagaaacaccagcatattaccaattgaagaagaaggtaaacac
ctggagccagggtatccattattgtcagcagagatagaagacatagaagatgcacaacaa
caggaagctgccctactgacaaggtggcaaaggattatggggattaattatgaaatagtg
gttgcccatgtgagcaagttcagtgagaacagcgggttggggataagtctggaagcaaca
gtgggacatcattttatccgatctgttctaccagaaggtcctgttggacacagtgggaag
cttttcagtggagatgaactgttggaagtgaatggcataactttgcttggggaaaatcat
caagatgtggtgaatattttaaaagaactgccaatagaagtgacaatggtgtgctgtcga
cgaactgtgccacccaccagccagtcaggattggatagtctggacttatgtgatattgaa
ctgacagaaaagcctcatgtagatctaggcgagttcattgggtcctcagagactgaggat
cctgtgctggcgatgactgatgtgagtcagaatgcggaggaggttcaaggacctttggcc
atgtgggaggttgatgttcaacacatcgagttggagaaagggaacaaaggacttggtttt
agcattttagattaccaggatcctattgatccaacaagcactgtgattgtaattcgttct
ttggtgcctggtggcattgctgaaaaggacggtaggcttcttcctggagacagactgatg
tttgtcaatgatgttaacctggagaacagcagtctcgaagaagctgtgcaggcactgaag
ggtgcgccatcgggaactgtgagaattggagttgctaaacctttacctctgtcaccagaa
gaagggtatgtttctgctaaggaggattcctttctccacccacgacactcttgcgaggag
gaagggccggctgacagagccctcttcagggctgacttggctctggtggacacaaatgag
gctgacttagcagatgaatctacatttgagtctcagtactctcctgataatgacagtatc
tactccactcaagcatctattttatctcttcacggcagtgcttgtagcgatggcctgaac
tatggtccctcccttccatcttctcctcccaaggatgtcactgaaaattcttcagatcca
gtacttgatctgcacatgtccttggaggaactgtacacccagaatctcctacaaagacag
gatgagagtccgtcttcagtagacttgagcatggctcctgcctctggctttactgtaaat
gattatacacctgcaaatgctattgaacagcaatacaaatgtgaaaacacaagaacatgg
gctgaatctcatctaccaaatgaaattatatcgagtgcagaacttacttctcccgtgctg
cctgattcaactggaaagggctccgagttcttaattcaacagagctctctgacctcaact
ggtgagtgtgtcatgcttcaaaacctatccaaagaaatgtttgagaggactattactata
gcaaaaggcaattctagcctagggatgacagtaagtgctaataaagatggcttggggatg
attgttcgaagcattattcatggaggttccatcagtcgagatggccggattgccgttggg
gactgcatcttatctattaatgaagaatctactatcagtttaaccaatgcccaggcacga
gcgatgttgagaagacactctctcattgggcctgacataaaaattacttatgtgcctgca
gaacatttggaagagttcaaaatcagtttggggcaacagccgggaggagtaatggcattg
gatgttttgtcttcatatactggcagagacattccagaactaccagagcgagaagaagga
gagggagaagaaagtgagcttcaaaatgcagcatacagtaattggaaccagcccaggcga
gttgaactttggagagaaccaagcaaatccttgggcatcagcattgttggtggaagaggc
atggggagtcgtctaagcaacggtgaagtgatgaggggcattttcatcaaacatgttctt
gacgatagtccagctggcaaaaatggaaccttgaaacctggagatagaatagtagaggtg
gatggaatggacctcagagatgcaagccatgagcaagctgtggaagccattcggaaagca
ggcaaccccgtagtctttatggtacagagcattataaacagaccaaggaaatcccctttg
ccttccttgccgcacaacctttaccctaagtacaacttcagcagcactaacccatttgct
gattctctacaattcaacgctgacaaggaattacagaattcaagtagagttaccttccgt
tgttccccaactaacccttttgctcccacaccatttaaggcacccagtcagtcggaatca
gagccagaaaaggctcccttgtccactgtgcctccgcccccttcttcagcatttgcagag
atgagcagtgatcatacacagtcatctgcaagcaaaatctcagaagatgtggataaagag
gatgagtttggttacagctggaaaaatgtcagagagcggtatggaaccctaacaggagag
ctacatatgattgaactggagaaaggtcgtagtggtttgggtctaagtcttgctgggaac
aaggaccgatccaggatgagtgtctttgtagtggggattgatccaaatggagcagctggg
aaagatggtcgactgcagattgcagatgagcttctagagatcaatggtcaaattttatac
ggaaggagtcatcagaatgcttcttcaatcattaaatgtgctccttcgaaagtgaaaata
atttttatcagaaataaagatgcggtaagtcagatggctgtatgtcctggaaatacagta
gaacctttgccttctgcctcagagaattctcaaaataaggaggccgagccaactggtact
acttccgatgcagctgtggacctctgttcatttaaaaacgtgcaacatctggagcttccc
aaggatcaagggggtttgggcattgctatcactgaggaagacacgctcagcggagttgtc
ataaagagtctaaccgagcacggggtagcagccaaggatggacggctcaaagtcggagat
cagattttggctgtagatgatgaagtcgttgttggctatcctgttgaaaagtttattagc
cttttgaaaacagcaaagacaacagtgaaacttagcattcgtgctgagaatcgcgaccct
caggctgtggcttcagcggcgggtgcagccagcggagaacagaagagcagctccttggct
ctgatggccccatcttctggttccccagaaccagagtccatcccaagtacaagcaggtca
tcaacaccagcgatctttgcttctgatcctgcgacctgccccattataccaggctgtgaa
acaacaattgaaatttccaaagggcgcacagggctgggcctgagcattgttggagggtct
gacactctgctgggtgccattattatccatgaagtttatgaagaaggagcggcatgtaaa
gatggaagactctgggctggagatcagattttagaggtgaacggaattgacttgagaaag
gccacccatgatgaagcaataaatgtcctgagacagaccccacaaagagtacgcctaaca
ctctacagagatgaggccccatacaaagaggaagatgtgtatgacacccttaccattgag
ctgcagaagaagccggggaaaggccttggattaagtattgttgggaaaagaaatgatacc
ggagtatttgtgtcagacattgtcaaaggagggattgcagatgctgatggaagactggtg
cagggagaccagatattaacggtgaacggagaagatgtccgtaatgccacccaggaagct
gtggctgctttgctaaagtgttccctaggcacagtgaccttggaagttggaagaatcaaa
gccggtccattccattcagagaggaggccttctcaaagcagccagatgagcgaaggcagc
ctgtcatcattcacttttccactttctggatccagtacatctgagtcactagaaagtagc
ctgaagaagaatgcattggcatctgaaatacaaggattaagaacagttgaaataaaaaag
gggcctgctgactcactgggaatcagcattgctggaggagtgggcagcccacttggtgat
gttcctatatttattgcaatgatgcacccaaatggagttgcagctcagacccaaaaactc
agagttggggatcggattgtcactatctgtggcacttccactgagggcatgactcacacc
caagcagttaacttactgaaaaatgcccctggctccattgaaatgcaggtggttgctgga
ggagatgtgagtgtggtcacaggtcatcagcaagagcctgccagttctagtctttctttc
actgcgctgacatcaagcagtatatttcaggatgatttaggacctcctcagtgtaaatct
attacactagaccgaggaccagatggcttaggcttcagtatagtaggagggtatggcagc
cctcatggagacttacccatttacgttaaaacagtgtttgcgaagggagcagcctccgaa
gacgggcgtctaaaaaggggtgatcagatcattgctgtcaatgggcagagtctggaaggg
gtaacccatgaagaagctgttgccatccttaagcggactaaaggaactgtcactttgatg
gttctctcctga

DBGET integrated database retrieval system