KEGG   Canis familiaris (dog): 474778Help
Entry
474778            CDS       T01007                                 

Gene name
COL15A1
Definition
(RefSeq) collagen alpha-1(XV) chain isoform X3
  KO
K08135  collagen, type XV, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    474778 (COL15A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cfa00535]
    474778 (COL15A1)
Proteoglycans [BR:cfa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   474778 (COL15A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endostatin Collagen Laminin_G_3 Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 474778
NCBI-ProteinID: XP_005626921
Ensembl: ENSCAFG00000002525
VGNC: 39460
UniProt: J9P689
Position
11
AA seq 1374 aa AA seqDB search
MAPRRDARSWRLLWLLSVSALLPAPTRTRSATELASQGPLDLTELIGVPLPSSVSFVTGY
GGFPAYSFGPGANVGRPARTLIPPTFFRDFAISVTVKPSSASGGVLFAITDAFQKVIYLG
LRLSGVEDGGQRVILYYTEPGSHVSHEAAAFLVPVLTHRWNRFAVIVQGEEVTLLMDCEE
HSHISFQRSSRALAFEPSAGIFVGNAGATGLERFTGSIQQLTIHPDPRTPEEMCETEESS
ASGESSGLQEPEGVAEILEAVTYTQAPSKEAKVEPINAPPTPSPPSDDTELSGEPVPEGT
AETVNLSVSLHSIPEQGSGEVLNDTLEEVHTVDGAPITDVGSGDGAFIHVTEEAVHTEEG
LAATEATGEAEVPTSTAGEAEASSMPTRGPALSLSTEDMGERVTLSVDAEEGSGATAAGE
AEVPDGTANETEADSVPTEGATLSMAVQDPGTGVTLGAVAEGMFTASAATTEVPGSTSEE
EEARQVPTGGLVPLPPTAAPEQAGAPGPGDEGELAAAVTAEPLPTAEAEAPEVGGSLPER
PPLPVPTVASERGVTPGEAGEGLFGHPEPARPTGPTVETEAEGSGLGWGSEIGFGSGDLV
RSEELLRGPPGPPGPPGSPGIPGKPGTDVFMGPPGSPGEDGAAGEPGPPGPEGQPGPDGA
SGLPGMKGEKGARGPNGSVGEKGDPGNRGLPGPPGKNGQVGSPGIMGPPGPPGPPGPPGP
GCAMGLGFEDTEGSGSIRLLHEPRISGPVAPSGPKGEKGDQGPKGDRGMDGASIVGPPGP
RGPPGRIEVLSSALTNITHGFMNLSDIPELIGPPGPEGIPGLPGFPGPRGPKGDTGVPGF
PGLKGEQGEKGEPGAILTGDIPLERLQGKKGEPGVHGAPGPMGPKGPPGHKGEFGLPGRP
GRPGLNGLKGAKGDRGVMMPGPPGLPGPPGPPGPPGAVINIKGAVFPIPARPHCKTPVDT
IHPGNSELITFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPVDPTYLRHFLNSLKGENG
DRGIKGEKGDSHGDFLVSGPPGLPGSPGLVGQKGETVVGPQGPPGAPGLPGPPGFGRPGS
PGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTAFSSMDDMLQKAHLVIEG
TFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPAFSSNPHQLPPPRMPLSSISYE
RPALHLVALNTPFSGDIRADFQCFQQARAAGLLSTYRAFLSSHLQDLSTVVRKAERYSLP
IVNLKGQVLFNNWDSIFSGHGGQFNAQVPIYSFDGRDVMTDPSWPQKVVWHGSSTHGVRL
VDKYCEAWRTADMAVTGLASPLSTGKILDQKTYSCANRLIVLCIENSFMTDARK
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaaggagggacgcgcgctcctggcgcctgctgtggctgctctcggtctccgcg
cttctccccgcgcccacccggacccgctcggcgacagagttggcttcccagggccccctg
gacctcacggagctcatcggcgtcccgctgccctcatctgtgtcctttgtcacgggctat
ggtggcttcccagcctacagcttcgggcctggtgccaacgtcggccgcccagccaggacc
ctcatcccacccaccttcttcagggacttcgccatcagcgtcacagtgaagcccagcagt
gccagcggtggggtgctctttgctatcaccgatgccttccagaaggtcatctacctgggc
ctgcggctctcgggcgtggaggatggtggccagcgggtcatcctctactacacggagcca
ggctcccatgtgtcccatgaggctgctgccttcctggtgcctgtgttgacccaccggtgg
aaccgctttgcggtgatcgtccagggcgaggaggtgaccctcctcatggactgtgaagag
cacagccacatctccttccagcggtcctcccgggccttggctttcgagcccagtgcaggg
atcttcgtgggcaatgcaggagccacggggctggagagattcaccggctccatacagcag
ctcaccatccaccctgaccccaggacccctgaggagatgtgtgaaactgaagaatcctcg
gcgtcaggagagagcagcgggcttcaggagccagagggagtagctgagatcttagaagct
gtcacctacactcaagccccctctaaagaagcaaaagttgaacccataaacgcacctcca
actccatcccctccttctgacgacacagaactttcgggtgagcccgtacccgaggggact
gcggaaactgtcaacttgagcgtcagcctgcatagcatcccagagcaagggtctggtgaa
gtcctgaatgacacactggaggaagttcatactgtggacggtgcccccattacagatgtt
ggctcgggggatggggccttcattcatgtcactgaggaggctgtgcatactgaagaaggt
ttggcagccacagaggccaccggggaggctgaggtgcccaccagcactgccggggaagcg
gaggccagcagtatgcccaccagggggccagctctctccttgtccactgaagatatgggg
gaaagggtcactctgagtgtagatgctgaagaaggctcgggagccacagcagctggggag
gccgaggtgcctgatggcaccgccaacgaaacagaggccgacagtgtgcccacagaggga
gcgaccctctccatggccgtccaggaccctgggacaggggttaccctgggtgcagtcgct
gaaggaatgttcacagcatcagcagccacgacggaagtgcccggcagcacgtctgaggag
gaggaggctcgccaggtccccacgggtggcctggttcccctcccacccacagcggccccc
gagcaagcgggcgcgcccgggcctggtgatgagggagagctggcagcagctgtgaccgcg
gagccccttcccacggctgaggctgaggcgccagaggtgggcggcagcctcccggagcgg
cccccgctgcccgtacccacagtggcctctgaaagaggggtcactccgggtgaagctggg
gaggggctttttggccaccctgaacctgccaggcctactggacccacggtggaaactgag
gccgagggctccggcctgggctggggctccgaaattgggtttggctctggggacttggta
cgcagtgaagagctgttaaggggtcccccaggtcccccgggccctcctggctcacctggg
attccaggaaaaccaggaactgatgttttcatgggaccccctggatcgcctggagaggat
ggagctgctggtgaacctgggcccccgggccccgagggacagcctggacctgatggagcc
tccggccttcctgggatgaagggagagaagggagcaagagggcctaatggctccgttggt
gaaaagggtgacccaggcaacagaggcttaccaggacctccagggaaaaatggacaagtc
ggcagtcccgggatcatgggacctccagggcctcctggacccccaggacccccaggccct
ggatgtgcaatgggacttgggtttgaggatactgaagggtccggaagcatcaggctattg
catgaaccgagaatctccggaccagtggctccaagtggtcccaaaggagaaaaaggagac
cagggacccaagggtgacagagggatggatggagccagcattgtggggccccccggaccc
agggggccaccaggtcgcatcgaagtcctgtctagtgctttgaccaacatcacccatgga
ttcatgaatctctcggacatccctgagctcattgggcctccgggtccggagggcataccc
gggctgccaggatttccaggccctcgaggaccaaagggtgacactggcgtgcctggattt
ccaggactaaaaggagaacagggcgagaagggagagccaggtgccatcctgaccggagat
attcctctggaacggctgcaggggaaaaagggtgaacctggagtgcacggagccccggga
ccaatggggcccaaaggaccgccaggacacaaaggagagtttggccttcctggacgacct
ggtcgcccgggactcaatggcctcaagggcgccaaaggagaccgaggggtcatgatgccg
ggcccacctggcttacctggtcctccgggtccccctgggcctcctggagctgtgattaac
atcaaaggagctgtcttccccataccagcgcggccgcactgcaaaacaccggttgatacc
attcatccggggaattcagaacttatcacctttcatggtgttaaaggagaaaaaggatcc
tggggtcttcctggctccaaaggagaaaaaggcgaccagggggcccagggaccaccaggc
cctccagtggatccaacttacctgagacactttctaaacagcttgaagggggagaatgga
gacagggggatcaaaggagaaaaaggagactctcacggtgatttcttggtgtcagggcct
ccaggcctgccgggaagtcctggcttggttggccagaagggggagactgtcgttgggccc
cagggacccccgggtgctcctggcctgcctgggcctcctggctttggaagacctggttcc
cctgggccaccgggacccccagggcccccaggaccaccagctatccttggtgcagctgtg
gcccttccgggtccacccggccctccaggacagccagggcttcccggatccagaaacctg
gttacggcatttagcagcatggatgacatgttgcagaaagcacacttggttattgaaggg
acattcatctacctgagggacagcactgagttcttcattcgggtccgagatggttggaag
aaattacagctgggagagctgatccccattccggctgacagcccaccgccccccgccttc
tccagcaatccacatcagcttccgcctccacggatgcccctttcaagcatcagttacgag
aggcctgcgctgcacctggttgccctgaacacgccattttctggggacatccgagctgat
tttcagtgcttccagcaggccagggctgcggggctgttgtccacctaccgagcattctta
tcctcccatctgcaagacctctccacggtggtgaggaaagcagagagatacagccttcca
atagtgaacctcaagggccaagtacttttcaacaattgggactcaattttttctggccat
ggaggacagttcaatgcacaggttccaatatactcctttgatggccgagacgtgatgacg
gatccttcctggccccagaaggtcgtttggcacggctccagcacccacggagtgcgtctt
gtggataagtactgtgaagcgtggcgaaccgctgacatggcagtcacgggactggcctcc
ccactgagcacagggaagattctggaccagaaaacatatagctgcgctaataggctaatt
gttctgtgtattgaaaacagtttcatgacagatgctaggaagtaa

DBGET integrated database retrieval system