KEGG   Canis familiaris (dog): 474780Help
Entry
474780            CDS       T01007                                 

Gene name
ALG2
Definition
(RefSeq) alpha-1,3/1,6-mannosyltransferase ALG2 isoform X2
  KO
K03843  alpha-1,3/alpha-1,6-mannosyltransferase [EC:2.4.1.132 2.4.1.257]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00510  N-Glycan biosynthesis
cfa01100  Metabolic pathways
Module
cfa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    474780 (ALG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    474780 (ALG2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.132  GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     474780 (ALG2)
    2.4.1.257  GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     474780 (ALG2)
Glycosyltransferases [BR:cfa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   474780 (ALG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 474780
NCBI-ProteinID: XP_022281355
Ensembl: ENSCAFG00000002532
VGNC: 37797
Position
11
AA seq 367 aa AA seqDB search
MAEKRGRDPEPGPSPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKLWTAHYDPGHCF
ADSRGLQVSACIPVLKLARRRKKILFYCHFPDLLLTRRDSFLKRLYRAPIDWIEEYTTGM
ADCILVNSRFTAAIFKETFKSLSHIEPDVLYPSLNVTSFDSTAPEKLDDLVPEGKKFLFL
SINRYERKKNLTLALEALVKLRGRLTSQDWDKVHLIMAGGYDERVLENVDHYQELKKMVQ
QSDLAQCVTFLRSFSDKQKISLLHGCTCVLYTPSHEHFGIVPLEAMYMQCPVIAVNSGGP
LESITHGVTGFLCEPDPVHFSEAMEKFIHEPSLKATMGLAGRARVKAKFSSEAFTEQLYQ
YVTKLLV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagcggggccgcgacccggagcctgggcccagcccgtcggtgctgtttctg
cacccggacctgggcgtgggcggcgccgagcggctggtgctggacgcggcgctggcgctg
caggcgcgcgggtgcagcgtgaagctctggacggcgcactacgaccccggccactgcttc
gcggacagccgcgggctgcaggtgtctgcctgcatcccagtgctcaagctggccagacgg
cgcaagaagatcctgttttattgtcacttcccagatctgcttctcaccaggagagattct
tttctgaaacgcctatacagggccccgattgactggatagaggaatacaccacaggcatg
gccgactgcatcttggtcaacagccggtttaccgctgccatttttaaggaaacattcaag
tcgctgtctcacatagaacccgatgtcctctacccatctctcaatgtcaccagctttgac
tccactgctcccgaaaagctcgatgacctcgtccccgaggggaagaagttcctgttcctc
tccatcaacagatacgaaaggaagaaaaatctgactttggcactggaagccctagtaaaa
ctgcgtgggagattgacatcccaagattgggacaaggtccatctaatcatggcaggtggc
tatgatgaaagagtcttggagaatgtggaccactatcaggaattgaagaaaatggtccaa
cagtctgaccttgcacagtgtgtgaccttcctgcggtctttctcagacaaacagaaaatc
tcactcctccacggctgtacctgtgtgctttacacaccaagccatgaacactttggcatc
gtccctttggaagccatgtacatgcagtgcccggtcatcgctgttaattcgggtgggccc
ttggagtccatcacccatggtgtcacagggtttctgtgcgagcctgacccagtgcacttc
tcagaagcaatggaaaagttcatccatgaaccttctttaaaagccacaatgggactggct
gggagagccagggtgaaagcaaagttttcctcggaagcctttacagaacagctctaccag
tatgtcaccaaactgctggtataa

DBGET integrated database retrieval system