KEGG   Canis familiaris (dog): 474856Help
Entry
474856            CDS       T01007                                 

Gene name
PPT2
Definition
(RefSeq) lysosomal thioesterase PPT2 isoform X1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00062  Fatty acid elongation
cfa01100  Metabolic pathways
cfa01212  Fatty acid metabolism
cfa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    474856 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    474856 (PPT2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     474856 (PPT2)
Lipid biosynthesis proteins [BR:cfa01004]
 Fatty acid synthase
  Component type
   474856 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1 DUF676 Abhydrolase_6 PGAP1
Motif
Other DBs
NCBI-GeneID: 474856
NCBI-ProteinID: XP_005627230
Ensembl: ENSCAFG00000000766
VGNC: 44930
UniProt: F1Q403
Position
12
AA seq 303 aa AA seqDB search
MLGRRGLRLPPVGILLLLPFLPPPLPPAAPAPHRAAYKPVIVVHGLFDSSYSFRHLLEYI
NETHPGTVVTVLDLFDGRESLRPLWEQVQGFGEAVAPIMAKAPQGVHLICYSQGGLVCRA
LLSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYW
HDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFF
GFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEP
WLS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgctggggcgccggggcctgcggctccccccggtggggatcctgctcctgctgccgttc
ctgccgccgccgctgccgcccgcagcccccgcgccccatcgcgctgcctacaaaccggtc
atcgtggtgcacgggctgtttgacagctcgtacagcttccgccacctgctggaatacatc
aacgagacacatcccgggactgtggtgacagtgcttgatctcttcgatgggagagagagc
ttgcgacccttgtgggaacaggtgcaagggtttggagaggctgtggcccccatcatggca
aaggcccctcaaggggtgcatctcatctgctactcgcaggggggcctggtgtgccgggcg
ctgctctccgtcatggatgagcacaatgtggattctttcatctctctctcttctccacaa
atgggacagtatggagatacggactatctgaagtggctcttccctacctccatgaggtct
aacctctaccggatctgctatagtccctggggccaggaattctccatctgcaactactgg
catgacccccaccatgatgacttgtacctcaatgccagcagtttcctggccctgatcaat
ggggagagagatcatcccaatgccactgcatggaggaagaactttcttcgtgtgggccgc
ctggtgctgattgggggccctgatgatggtgtcattaccccctggcagtccagcttcttt
ggtttctatgatgcaaatgagaccgtcttggagatggaggagcaactggtttatctgcgg
gattcttttgggttgaagacgctgttggctcggggagccatagtgaggtgtccgatggct
gggatctcccatacggcctggcactccaaccggaccctttatgagacctgcattgaacct
tggctctcctga

DBGET integrated database retrieval system