KEGG   Canis lupus familiaris (dog): 474860
Entry
474860            CDS       T01007                                 

Gene name
HLA-DRB1
Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain precursor
  KO
K06752  MHC class II antigen
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04145  Phagosome
cfa04514  Cell adhesion molecules
cfa04612  Antigen processing and presentation
cfa04640  Hematopoietic cell lineage
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04672  Intestinal immune network for IgA production
cfa04940  Type I diabetes mellitus
cfa05140  Leishmaniasis
cfa05145  Toxoplasmosis
cfa05150  Staphylococcus aureus infection
cfa05152  Tuberculosis
cfa05164  Influenza A
cfa05166  Human T-cell leukemia virus 1 infection
cfa05168  Herpes simplex virus 1 infection
cfa05169  Epstein-Barr virus infection
cfa05310  Asthma
cfa05320  Autoimmune thyroid disease
cfa05321  Inflammatory bowel disease
cfa05322  Systemic lupus erythematosus
cfa05323  Rheumatoid arthritis
cfa05330  Allograft rejection
cfa05332  Graft-versus-host disease
cfa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    474860 (HLA-DRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    474860 (HLA-DRB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    474860 (HLA-DRB1)
   04612 Antigen processing and presentation
    474860 (HLA-DRB1)
   04658 Th1 and Th2 cell differentiation
    474860 (HLA-DRB1)
   04659 Th17 cell differentiation
    474860 (HLA-DRB1)
   04672 Intestinal immune network for IgA production
    474860 (HLA-DRB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    474860 (HLA-DRB1)
   05164 Influenza A
    474860 (HLA-DRB1)
   05168 Herpes simplex virus 1 infection
    474860 (HLA-DRB1)
   05169 Epstein-Barr virus infection
    474860 (HLA-DRB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    474860 (HLA-DRB1)
   05152 Tuberculosis
    474860 (HLA-DRB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    474860 (HLA-DRB1)
   05140 Leishmaniasis
    474860 (HLA-DRB1)
  09163 Immune disease
   05310 Asthma
    474860 (HLA-DRB1)
   05322 Systemic lupus erythematosus
    474860 (HLA-DRB1)
   05323 Rheumatoid arthritis
    474860 (HLA-DRB1)
   05320 Autoimmune thyroid disease
    474860 (HLA-DRB1)
   05321 Inflammatory bowel disease
    474860 (HLA-DRB1)
   05330 Allograft rejection
    474860 (HLA-DRB1)
   05332 Graft-versus-host disease
    474860 (HLA-DRB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    474860 (HLA-DRB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    474860 (HLA-DRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    474860 (HLA-DRB1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474860 (HLA-DRB1)
  Exosomal proteins of epithelial cells
   474860 (HLA-DRB1)
  Exosomal proteins of breast milk
   474860 (HLA-DRB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig C2-set_2 DUF202
Other DBs
NCBI-GeneID: 474860
NCBI-ProteinID: NP_001014768
Ensembl: ENSCAFG00000000806
UniProt: P18470
Position
12
AA seq 266 aa
MVCLCFLGGSWMTALMLILMVLNPPFAWARDTPPHFLEVAKSECYFTNGTERVRFVERYI
HNREEFVRFDSDVGEFRAVTELGRPVAESWNGQKEILEQERATVDTYCRHNYGVIESFTV
QRRVEPTVTVYPTKTQTLQHHNLLVCSVNGFYPGHIEVRWLRNGQEEEAGVVSTGLIRNG
DWTFQILVMLEIVPQSGEVYTCQVEHPSLTSPVTVEWRAQSDSAQSKMLSGIGGFVLGLL
FLAVGLFIYFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgtgttttcttggaggctcctggatgacagctctgatgctgatactgatg
gtgctgaaccctcccttcgcttgggccagggacaccccaccacatttcttggaggtggca
aagtccgagtgctatttcaccaacgggacggagcgggtgcggttcgtggaaagatacatc
cataaccgggaggagttcgtgcgcttcgacagcgacgtgggggagttccgggcggtcacg
gagctcgggcggcccgtcgctgagtcctggaacgggcagaaggagatcttggagcaggag
cgggcaacggtggacacctactgcagacacaactacggggtgattgagagcttcacggtg
cagcggcgagtcgagcctacagtgactgtgtatcctacgaagactcagaccttgcagcat
cacaacctcctggtctgctctgtgaatggtttctatccaggccacattgaagtcaggtgg
ctccggaatggccaggaagaggaagctggggttgtgtccacaggcctaatccgtaatgga
gactggaccttccagatcctggtgatgctggagatagttcctcagagcggagaggtctac
acctgccaagtggagcacccaagtttgacaagccctgtcaccgtggaatggagggcacag
tctgattctgcacagagcaagatgctgagtggaatcgggggctttgtcctgggtctgctc
ttccttgcagtggggctgttcatctacttcagaaatcagaagggacactctggacttcag
ccaacaggactcctgagctga

DBGET integrated database retrieval system