KEGG   Canis familiaris (dog): 474919Help
Entry
474919            CDS       T01007                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04141  Protein processing in endoplasmic reticulum
cfa04151  PI3K-Akt signaling pathway
cfa04217  Necroptosis
cfa04612  Antigen processing and presentation
cfa04621  NOD-like receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04659  Th17 cell differentiation
cfa04914  Progesterone-mediated oocyte maturation
cfa04915  Estrogen signaling pathway
cfa05200  Pathways in cancer
cfa05215  Prostate cancer
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    474919 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    474919 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    474919 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    474919 (HSP90AB1)
   04612 Antigen processing and presentation
    474919 (HSP90AB1)
   04659 Th17 cell differentiation
    474919 (HSP90AB1)
   04657 IL-17 signaling pathway
    474919 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    474919 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    474919 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    474919 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    474919 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    474919 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfa01009]
    474919 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfa03110]
    474919 (HSP90AB1)
   04131 Membrane trafficking [BR:cfa04131]
    474919 (HSP90AB1)
   03051 Proteasome [BR:cfa03051]
    474919 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    474919 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    474919 (HSP90AB1)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     474919 (HSP90AB1)
Chaperones and folding catalysts [BR:cfa03110]
 Heat shock proteins
  HSP90
   474919 (HSP90AB1)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    474919 (HSP90AB1)
Proteasome [BR:cfa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    474919 (HSP90AB1)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    474919 (HSP90AB1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   474919 (HSP90AB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 474919
NCBI-ProteinID: XP_005627460
Ensembl: ENSCAFG00000001981
UniProt: E2RLS3
Position
12
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgccttccaggcagaa
attgcccagctcatgtccctcatcatcaataccttctattctaacaaggaaatttttctt
cgagagttgatcagtaatgcttctgatgccttggacaagattcgctatgaaagcctgaca
gacccttccaagttggacagtggtaaagagctgaaaattgacatcatccctaacccccag
gaacgcaccctgactctggtggacacaggcattggtatgaccaaagctgatctcataaat
aacttgggaaccattgccaagtctggcactaaagcattcatggaggcccttcaggctggt
gcagacatctccatgattggacagtttggtgttggcttttattctgcttatctggtggca
gagaaagtggttgttatcacaaagcacaatgatgatgagcagtatgcgtgggagtcttct
gctgggggctctttcactgtacgtgcagaccatggtgagcccattggccggggtaccaaa
gtgatcctccatcttaaagaagaccaaaccgaatatttagaggagagacgtgtcaaagaa
gtggtgaagaagcactcccagttcataggttatcccatcactctttatttggagaaggaa
cgagagaaggaaattagtgatgatgaggcagaggaggagaaaggggagaaagaggaagaa
gataaagatgatgaggaaaaacccaaaattgaagatgtgggttcagatgaggaggatgat
agtgggaaggacaagaaaaaaaagaccaagaagattaaggaaaaatacattgatcaagaa
gaactgaacaagaccaagcccatttggaccagaaaccctgatgacatcacccaggaggaa
tatggagagttttacaagagccttactaatgactgggaagatcacctggcagtcaagcac
ttctctgtagaaggtcagctggaattcagggcattgctgttcatccctcgtcgggctcct
tttgacctctttgagaacaagaagaaaaagaacaatatcaaactgtatgtccgccgtgtg
tttatcatggacagctgtgatgaattgataccagagtatctcaacttcatccgtggtgtg
gttgactccgaggacctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaggtcattcgcaaaaatattgtgaagaagtgccttgagctcttctctgaattggca
gaagacaaggagaactataagaaattctatgaggcattctctaaaaacctaaagcttgga
atccatgaagattccactaaccggcgccgcctttctgagctgctgcgttaccacacttcc
caatctggagatgagatgacttctctttcagagtatgtgtcccgtatgaaggagactcag
aaatccatctattacatcactggtgagagcaaagagcaggttgccaactccgcttttgtg
gagcgagtgcggaaacggggcttcgaggtagtgtatatgacagagcctatcgacgagtac
tgcgtgcaacagctcaaggagtttgatgggaagagtctggtctcagttaccaaggagggc
ctggagttgcctgaggatgaagaggagaagaagaaaatggaggagagcaaggccaagttc
gagaatctctgcaaactcatgaaggaaatcttggataagaaggttgaaaaggtgaccatc
tctaacaggctggtatcttcaccctgctgcatcgtgactagcacttatggctggactgcc
aacatggagcggatcatgaaagcccaggcactccgggacaactctacaatgggctatatg
atggccaaaaagcatctggagatcaaccctgaccaccccattgtggagacgctgcggcag
aaggcagaggcagataagaacgacaaggctgtcaaggacctggtggtgctactgtttgaa
acagctctactctcctccggcttctcactggaggatccccagactcactccaaccgcatt
taccgcatgatcaagctaggcctgggcatcgatgaagatgaagtggcagcggaggaaccc
agtgctgctgttcctgatgagatccctccacttgagggtgatgaggatgcctctcgcatg
gaagaagtcgattaa

DBGET integrated database retrieval system