KEGG   Canis familiaris (dog): 474945Help
Entry
474945            CDS       T01007                                 

Gene name
COL21A1
Definition
(RefSeq) collagen alpha-1(XXI) chain isoform X1
  KO
K16629  collagen, type XXI, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    474945 (COL21A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen VWA VWA_2 VWA_3 Laminin_G_2 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 474945
NCBI-ProteinID: XP_005627552
Ensembl: ENSCAFG00000002348
VGNC: 39467
UniProt: E2RIU7
Position
12
AA seq 957 aa AA seqDB search
MAHHITFLWIVLVLLLQNSVLAEDGEIRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNITKNFDIGPKFIQVGVVQYSDYPVLEIPLGSHDSGKNLVAAMESIHYLGGNTRTGKAI
QFALDYLFAKSSRFLTKIAVVLTDGKSQDEVKDAAEAARDSKITLFAIGVGSETEDAELR
AIANKPSSTYVFYVEDYIAISKIREVMKQKLCEESVCPTRIPVAARDEKGFDILLGLGVK
KKVKKRILLSPTKIKGYEVTSKVDLSEFTSNVFPEGLPPSYVFVSTQRFKVKKMWDLWRI
LTIDGRPQIAVTLNGVDKTLLFTTTSMINGSQVVTFVDPQVKTLFDEGWHQIRLLVTEQD
VTLYIDDQQIENKPLHPVLGIFISGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFNGECLNGPSDVGSTPAPCVCPPGKPGLQGPKGEPGQPGNPGYPGQSGQDGKPGY
QGIAGSPGVPGSPGIQGVQGLPGYKGEPGRDGEKGDRGLPGFPGLHGIPGLKGEMGPKGD
KGSTGFYGKKGAKGEKGNSGFPGLPGRAGEPGRHGKDGLMGSPGYKGEVGPPGAPGQDGS
RGEPGIPGFPGNQGLMGQKGEIGPPGPLGKKGAPGIPGLMGRDGSPGQPGTPGSKGNKGE
PGLQGMPGASGLKGEQGAVGPPGEPGYLGLPGIQGKKGDKGSQGEKGIQGQKGENGRQGI
PGQQGIQGHHGMKGERGEKGEPGVRGATGPKGESGVDGLMGPVGPQGQPGEAGPQGPPGL
DGKPGREFSEQFIRQVCTDVLRAQLPVLLQSGRIQSCDHCQSQHGSPGIPGPPGPIGPEG
PRGFPGLPGRDGVPGLVGAPGRPGARGLKGLPGRNGAKGSQGFGYPGEQGPPGPPGPEGP
PGISKEGPPGDPGLPGKDGDHGKPGIQGQPGPPGICDPSLCFSVIVGRDPFRKGPNY
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccatattacatttctttggatagttttggtcctgcttcttcagaattctgta
ttagctgaagatggggaaataagatcaagttgtcgtactgctccaacagatttagttttc
atcctagatggctcttacagtgttggtccagaaaactttgaaatagtgaaaaagtggctt
gtcaatatcacaaaaaactttgacataggaccgaagtttattcaggttggagtggtccag
tatagtgactaccctgtattggagattcctcttggaagccatgattcaggaaagaatttg
gtggcagcaatggaatccatacattacctgggcggaaacacaaggactggaaaggccatc
cagtttgcacttgattacctttttgccaagtcctcacggtttctgactaagatagcagta
gtacttacagatggtaaatcccaagatgaagttaaagatgcagcagaagcagcaagagat
agtaaaataacattatttgctattggcgttggttcagaaacagaagatgcagaacttaga
gctattgccaataagccttcatctacttacgtgttttatgtggaagactatattgcaata
tccaaaataagggaggtgatgaagcagaaactttgtgaagaatctgtctgtccaacacga
attccagtggcagctcgcgatgagaaagggtttgatattcttttaggcttgggtgtaaag
aaaaaggttaagaaaagaatcctgctttcaccaacaaagataaaaggatatgaagtaaca
tcaaaagttgacttatcagaattcacaagcaatgttttcccagaaggtcttcctccatca
tatgtatttgtctccactcagagatttaaagtcaagaaaatgtgggatttatggagaatt
ttaaccattgatggaaggccacaaatagcagttactttaaatggtgtggataaaacttta
ctatttacaacaaccagcatgattaatggctcacaagtggtcaccttcgttgaccctcaa
gttaagacattatttgatgaaggctggcatcaaattcgtctcttagtaacagaacaagat
gtaactctgtatattgatgatcaacaaattgaaaacaagcccttacatccagttttaggg
atcttcatcagtgggcaaactcaaattggaaagtattctgggaaagaagaaaccgttcag
tttgatgtccagaagttgcgaatctactgtgacccagaacagaacaaccgagagacagca
tgcgagattcctggatttaatggcgagtgccttaatggtcccagtgatgttggctcaact
ccagctccctgtgtttgtcctccgggaaaaccaggactgcagggtcccaagggtgaacct
ggacagcctgggaaccctggctaccctggacaatctggtcaagatggtaagcctggatat
cagggaattgcaggatcaccaggtgtcccaggatccccgggaatacaaggagttcaagga
ctaccaggttacaaaggagaaccagggagagatggtgaaaagggtgaccgtggacttcct
ggttttccagggcttcatggaatcccaggattaaagggtgaaatgggccccaaaggagat
aaaggatcaactggattttatggcaaaaagggtgcaaaaggtgaaaaggggaattctggt
tttcctggcctccctggacgtgctggagaaccaggaagacatggcaaggatggattaatg
ggtagccctggttataagggagaagtaggacctccaggtgctccaggtcaggatggatca
cggggagagcctggaataccaggatttcctggaaaccaaggattaatgggacaaaaggga
gaaattgggcctccaggaccactaggaaaaaaaggagctccggggattcctggtttaatg
ggacgtgatggctcaccaggtcagcctggaacaccaggatctaagggaaataaaggtgaa
cctggacttcaagggatgcctggggcttctggactaaagggagaacaaggagcagtaggt
cccccaggagaaccaggatacctgggtttacctggaattcaaggaaaaaagggggacaaa
ggaagtcaaggtgaaaaaggcattcagggccaaaagggagaaaatggaagacagggaatt
ccagggcaacagggaattcaaggccatcatggtatgaaaggagagagaggtgagaagggg
gagcctggtgtcagaggtgccactggaccaaaaggagagtctggggtggacggcctaatg
gggcctgtgggcccccaggggcagcctggggaagcaggtccgcagggacctccaggacta
gatgggaagcccgggagagaattttcggaacagtttattcgacaagtttgcaccgatgta
ttaagagctcagctaccagtcttacttcagagtggaagaattcaaagttgtgatcattgc
cagtcccaacatggttcccctggtatacctgggccacctggtcccataggcccagaaggt
ccaagaggatttcctggtttaccaggaagagatggtgttcctggattagttggtgctcct
ggacgtccaggtgccagaggattaaaaggcctaccaggaagaaatggggcaaagggaagc
caagggtttgggtaccccggagaacagggtccccctggtcccccaggtccagagggccct
cctggaataagcaaagaaggtcctccaggagatccaggtctcccaggcaaagatggagat
catggaaaacccggaatccaagggcaaccaggaccccctggcatctgtgatccctcacta
tgttttagtgtaattgttggaagagatccatttagaaaaggaccaaactattag

DBGET integrated database retrieval system