KEGG   Canis familiaris (dog): 475070Help
Entry
475070            CDS       T01007                                 

Gene name
EIF3E
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit E
  KO
K03250  translation initiation factor 3 subunit E
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03013  RNA transport
cfa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    475070 (EIF3E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    475070 (EIF3E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cfa03012]
    475070 (EIF3E)
   03051 Proteasome [BR:cfa03051]
    475070 (EIF3E)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    475070 (EIF3E)
Translation factors [BR:cfa03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    475070 (EIF3E)
Proteasome [BR:cfa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    475070 (EIF3E)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   475070 (EIF3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_N PCI CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-GeneID: 475070
NCBI-ProteinID: XP_532304
Ensembl: ENSCAFG00000000702
VGNC: 40271
UniProt: E2R1J6
Position
13
AA seq 445 aa AA seqDB search
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
NIEKKLNQNSRSEAPNWATQDSGFY
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtacgacttgactactcgcatcgcgcactttttggatcggcatctagtcttt
ccgttgcttgagtttctctccgtaaaagagatatataatgaaaaagaattattacaaggg
aaattggatcttcttagtgataccaacatggtagactttgctatggatgtatacaaaaac
ctttattctgatgatattccacatgctttgagagaaaaaagaaccacagttgttgcacaa
ctgaaacagcttcaggcagaaacggaaccaattgtgaagatgtttgaagatccagaaact
acaaggcagatgcagtcaaccagagatggccggatgctgtttgactacctggcagacaag
catggttttaggcaggaatatttagatacactctataggtatgcaaaattccaatatgaa
tgtgggaattattctggagcagctgagtatctttacttctttagagtgttggttccagca
acagatagaaatgctttgagttcactctggggaaaactggcgtctgaaatcttaatgcag
aattgggatgcagctatggaagaccttacacggttaaaagagaccatagataataattct
gtgagttctccacttcagtctcttcagcagcgaacatggctcatccactggtctctgttc
gttttctttaaccaccccaaagggcgtgataacataattgatctcttcctctaccagccg
cagtaccttaatgcaattcagacaatgtgtccacatattctgcgatatttgactacagcc
gtcataacaaacaaagatgttcggaaacgccgacaggtgctaaaagatcttgttaaagtt
attcaacaggagtcttacacatataaagacccaattacagaatttgttgaatgcttatat
gttaactttgattttgatggggctcagaaaaagctgagggaatgcgaatcagtacttgtg
aatgacttcttcttggtggcttgtcttgaggatttcattgaaaatgctcgtctcttcata
tttgagactttttgtcgcatccaccagtgtatcagcattaacatgttggcagacaaactg
aacatgactccagaagaagctgaaaggtggattgtaaatttgattagaaatgctagactg
gatgccaagattgattctaaattaggtcatgtggttatgggtaacaatgcagtctcacca
tatcagcaagtgattgaaaagaccaaaagcctttcatttagaagccagatgttggccatg
aatattgagaagaaacttaatcagaatagtaggtcagaggctcctaactgggcaactcag
gactctggcttctactga

DBGET integrated database retrieval system