KEGG   Canis familiaris (dog): 475234
Entry
475234            CDS       T01007                                 

Gene name
PON1
Definition
(RefSeq) serum paraoxonase/arylesterase 1
  KO
K01045  arylesterase / paraoxonase [EC:3.1.1.2 3.1.8.1]
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    475234 (PON1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     475234 (PON1)
   3.1.8  Phosphoric-triester hydrolases
    3.1.8.1  aryldialkylphosphatase
     475234 (PON1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   475234 (PON1)
  Exosomal proteins of other cancer cells
   475234 (PON1)
SSDB
Motif
Pfam: Arylesterase SGL Str_synth Lactonase
Other DBs
NCBI-GeneID: 475234
NCBI-ProteinID: XP_850219
Ensembl: ENSCAFG00000002114
VGNC: 44812
UniProt: E2RPW3
Position
14
AA seq 355 aa
MAKLMVLTLLGLGLALFRDHRASYLTRLNAFREVTPVELPNCNLVKGIETGSEDLEILPN
GLAFISSGLRYPGIKSFEPDKPGKMLLVDLNEEDQTVLELKIIGSKFDEYSFNPHGISTF
TDEDNTVYLLVVNHPDFKSTVEVFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYA
TNDHYFTDVYLKSWELYLGLAWSYVVYYSPTEVQVMADGFDFANGINISPDGKYVYISEL
LAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPVTGDLWVGCHPNGIRIFFYDSENPP
ASEVIRIQNILTEEPKVRVVYADNGTVLQGSTVASVYKGKLLVGTVFHKALCCEL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcaaagctgatggtgctcaccctcttggggctgggactagcgctcttcagagatcac
cgggcttcttatctaacacgactcaatgctttccgagaagtaaccccagtagaacttcct
aactgtaatttagttaaaggaatagaaactggctctgaagacttggagatacttcctaat
ggactagctttcattagctctggattaagatatcctggaataaagagctttgaacctgat
aaacctggcaaaatgcttctagtggacctgaatgaagaagatcaaacagtgttagaactg
aagatcattggaagtaaattcgatgagtactcatttaaccctcatgggattagcacattc
acagatgaagataatactgtgtacctgctggtggtgaaccatccagattttaagtccaca
gttgaggtgtttaagtttcaagaagaagaaaaatcacttttgcatttgaaaaccatcaga
cacaaacttctgcctaatttaaatgatattgttgctgtgggacctgagcacttttacgcc
acaaatgatcactattttactgatgtctacttgaaatcctgggagctctatttgggttta
gcgtggtcttatgttgtttactatagtccaactgaagttcaagtgatggcagacggattt
gattttgctaatggaatcaacatttcacctgacggcaagtatgtctatatatctgaattg
ctggctcataagattcatgtgtatgaaaagcacgctaattggactttaactccattgaag
tccctggactttaataccctcgtggataatatatccgtggatcctgtgacaggggacctt
tgggttggatgccatcccaatggcataaggatcttcttctatgactcggagaatcctccc
gcatcagaggtgatccgaatccagaacattttaacagaagaacccaaggttagagtggtt
tatgcagacaatggtacagtgttgcaaggaagtaccgtggcctctgtgtataaagggaaa
ctgctggtcggcactgtgttccacaaagctctttgctgcgagctctag

DBGET integrated database retrieval system