KEGG   Canis familiaris (dog): 475371Help
Entry
475371            CDS       T01007                                 

Gene name
IPP
Definition
(RefSeq) actin-binding protein IPP isoform X1
  KO
K13956  actin-binding protein IPP
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    475371 (IPP)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     475371 (IPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BTB BACK Kelch_3 Kelch_2 Kelch_4 Kelch_5 DUF3342
Motif
Other DBs
NCBI-GeneID: 475371
NCBI-ProteinID: XP_005629105
Ensembl: ENSCAFG00000004445
VGNC: 42070
Position
15
AA seq 584 aa AA seqDB search
MANEACPKAGDSPFSSDKHAQLILAQVNKMRNGEHFCDVQLQVGKETFKVHRLVLAASSP
YFAALFTGGMKESSKDVVQILGIEAGIFQILLDFIYTGIVNIGVNNVQELIVAADMLQLT
EVVNLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFTENYIHVHFLEVHSGEEFLALTK
DQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVLEPIRFPLLPPQRLLKYI
EGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKVRPRKKARKYLYAVGGYTRLQ
GGRWSDSRALSCVERFDTFSQYWTTVSSLHQARCGLGVAVLGGMVYAIGGEKDSMIFDCT
ECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERYDPDENKWEVV
GNMALSRYYFGCCEMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGV
AALNDCIYSVGGWNETQDALHTVEKYSFEEEKWVEVASMKVPRAGMCVVAVNGLLYVSGG
RSSSHDFLAPGTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgaggcctgtcccaaggctggtgatagtcctttttcatcagataaacatgcc
caactcatcttggcccaggtcaataaaatgaggaatggagagcatttctgtgatgtgcag
ttacaagttggaaaggaaacttttaaagttcatcgactggttttggctgccagtagtcct
tactttgcagctttgttcactggaggaatgaaagagtcctcaaaagatgttgtacagatt
ctaggaattgaagctggaatctttcaaatacttctagatttcatttatacaggtatagtg
aatataggtgtgaataacgtccaggaactgattgtcgcagcagacatgctacagttgact
gaagttgttaatctgtgctgtgaatttctgaaaggacagattgatccattgaactgcatt
gggatctttcagttctctgagcaaattgcctgccatgaccttttggaattcacagaaaac
tacattcatgtccatttcttagaggttcatagtggggaagagttcctggcacttacaaaa
gatcaattgatcaaaattttgcgaagcgaagagctcagtattgaggatgagtatcaggtc
ttcttagctgcaatgcaatggattctgaaggacctgggaaaaagaagaaaacatgtggtg
gaagtactagaaccaattcgattccctttattacctcctcagaggcttttaaagtatata
gaaggagtatccgattttaatcttcgtgttgcattgcaaacacttttgaaagagtactgt
gaggtgtgcaaatctcccaaagagaacaagttttgtagttttctgcagacatctaaagtt
cgacctcggaagaaagcaagaaagtacctgtatgcagtaggtggatatactcggttgcag
gggggtcgttggagtgatagcagagctctcagctgtgtagaacgttttgacacctttagc
cagtattggaccactgtgtcttcacttcatcaggctcgatgcgggctgggagtagcagtt
ctgggagggatggtttacgctattggaggtgaaaaggattcaatgatttttgactgtacc
gaatgctatgatccagttactaaacagtggacaactgtagcttcaatgaatcacccccgc
tgtggcttgggagtgtgtgtgtgttatggggctatctatgctttgggtggatgggttgga
gctgagatagggaacaccattgaacgatatgatcctgatgaaaataagtgggaagtagtt
ggcaacatggctctgtcgcgctactactttgggtgttgtgaaatgcaaggtttaatttac
gtaattgggggcatcagcaatgaaggaatagagcttcgttcttttgaagtgtatgatcca
ctttctaagcgttggtctccacttcctccaatgggaaccaggagagcataccttggtgta
gctgcactcaatgactgtatatattctgttggagggtggaatgagacacaagatgctctt
catactgtagaaaaatattccttcgaagaggaaaagtgggttgaagttgcctcaatgaaa
gtgcctagagcaggcatgtgtgttgtggcagtcaatgggcttctgtatgtttctggaggt
cgatcttccagccatgatttcttggctccaggtaccttggattcagttgaagtttataac
cctcattcagatacatggacagaaatcggtaacatgatcaccagtcgttgtgaaggaggt
gttgctgtactatga

DBGET integrated database retrieval system