KEGG   Canis lupus familiaris (dog): 475393
Entry
475393            CDS       T01007                                 

Gene name
PNP
Definition
(RefSeq) purine nucleoside phosphorylase
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00230  Purine metabolism
cfa00240  Pyrimidine metabolism
cfa00760  Nicotinate and nicotinamide metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    475393 (PNP)
   00240 Pyrimidine metabolism
    475393 (PNP)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    475393 (PNP)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     475393 (PNP)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 475393
NCBI-ProteinID: XP_532617
Ensembl: ENSCAFG00000005419
VGNC: 44751
UniProt: F1PQM1
Position
15
AA seq 289 aa
MESGFTYEDYQNTAKWLLCRTKHRPQVAVICGSGLGNLADRLTEAQSFDYSEIPNFPRST
VPGHAGRLVFGFLNGKVCVMMQGRFHMYEGYSLSKVTFPVRVFFLMGVDTLVVTNAAGGL
NREFEVGDIMLIRDHINLPGFSGWNPLQGPNDERFGVRFLAMSDAYDRDMRQKAHSTWKQ
MGEQRELKEGTYVMVTGPSYETVAECSLLQQLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVILDYETRERVNHEEVLEAGKQAARKLEQFVSLLMTSIPPPSKAG
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagagcggatttacgtatgaagactatcagaacaccgccaagtggcttctgtgccgc
accaagcaccggccgcaggtggcggtcatctgtgggtccgggttgggaaatctggcggac
agactgacggaggcccagagctttgactacagcgagataccaaacttcccccgtagtaca
gtgccgggtcatgctggtcggctggtgtttgggttcctgaatggcaaagtctgcgtgatg
atgcagggcaggttccacatgtatgaaggctactcgctctcgaaggtgacgttccccgtg
agagttttcttcctcatgggtgtggacaccctcgtggtcaccaatgcagccggaggactc
aaccgtgagtttgaggttggagatattatgctgatccgtgatcacatcaacctaccaggc
ttcagtggttggaacccccttcaagggcccaatgatgaaaggttcggagtccgtttcctt
gccatgtctgatgcctatgaccgggacatgaggcagaaggctcacagtacctggaaacag
atgggggagcagagagagctgaaggaaggcacctatgtgatggtgacaggccccagctat
gagaccgtggccgagtgttccctgctgcagcagctgggggcagatgctgttggcatgagc
acggtgccagaagtcatagtcgcgaggcactgtggactccgggtgtttggcttctctctc
atcactaacaaagtcatcctggattatgaaacccgggagagggtgaatcatgaggaagtg
ctagaggcggggaaacaagctgcacgaaaactggaacagtttgtctcccttctcatgacc
agtatcccacctcccagcaaagccggctaa

DBGET integrated database retrieval system