KEGG   Canis lupus familiaris (dog): 475624
Entry
475624            CDS       T01007                                 
Symbol
KLKB1
Name
(RefSeq) plasma kallikrein
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    475624 (KLKB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    475624 (KLKB1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     475624 (KLKB1)
Peptidases and inhibitors [BR:cfa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   475624 (KLKB1)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 475624
NCBI-ProteinID: NP_001229646
Ensembl: ENSCAFG00000007348
VGNC: 42484
UniProt: A0A5K1VKB9
Position
16:complement(44979694..45003202)
AA seq 636 aa
MISFRQAAYFTCFFATVSCGCLTQLYKNTFFKGGDLTAMYTPNAHHCQMMCTFHPRCLLF
SFLPESSTNDVNKRFGCFLKDSVTETLPRMSWTSAISGHSLKQCGHQISACHRDIHKGID
MRGVNFNVSKVKSVEECQKKCTNSIHCQFFTYATETFYNVEYRNSCLLKNGPGGTPSSIK
VLADVVSGFSLKSCALSEIGCHMNIFQHLAFSDVDVARVVTPDAFVCQTICTYHPNCLFF
TFYTKAWHLEPQRNVCFLKTSKSGTPSSPTSQKNAMSGYSLLTCKKALPEPCHSKIYSGV
DFEGEELNVTFAEGVNACQETCTKMIRCQFFTYSLRPEDCRGEKCKCSLRLSLDGSPTGM
TYGTRVSSGYSLRLCKSGDSSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLRAQSHLCG
GSIIGRQWVLTAAHCFDELSLPDVWRIYSGILNLSEITKETPFSQIKEIIIHQNYKITDG
GSYDIALIKLEAPLNYTEFQKPICLPSKDDTNTTYTNCWVTGWGFTKERGEIQNSLQKAN
IPLVPNEECQKKYRDYEVNKQMICAGYKEGGKDACKGDSGGPLVCKHNGNWHLVGITSWG
EGCGRREQPGVYTKVAEYVDWILEKTQVGDGHAGLG
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgatttcattcaggcaagccgcttatttcacttgcttctttgctacagtttcctgtgga
tgcctgactcaattatataaaaacaccttcttcaaaggtggggacctaactgccatgtat
accccgaatgcccatcactgtcagatgatgtgcacattccaccccaggtgtttgctcttc
agttttcttcctgaaagttcaactaatgatgtaaacaaaagatttggttgctttttaaaa
gacagtgttacagaaaccctgccaagaatgtcatggacaagtgcaatttctggacattcc
ttaaagcaatgtggtcatcaaataagtgcttgccaccgagacattcataaaggaattgat
atgagaggagtcaattttaatgtctctaaggtaaaaagtgttgaagaatgccaaaaaaag
tgcaccaatagcattcactgccaatttttcacatatgccactgaaacattttacaacgta
gagtaccgaaacagctgccttttaaagaatggtccaggaggaacacccagcagtataaag
gtgctggctgatgtggtatctggattctcactgaagtcctgtgcactctcagaaattggt
tgccacatgaacattttccagcacctggcattttcggatgtggacgttgccagagttgtc
accccagatgcttttgtgtgccaaaccatttgcacctaccatcccaactgcctcttcttt
acattctacacaaaggcgtggcatctagaaccgcaaagaaatgtttgctttcttaagact
tccaaaagcgggacaccaagttcacccacttctcagaaaaatgccatgtccggatacagc
cttttaacctgcaagaaagctttgcctgagccgtgtcattccaaaatttactcaggagtg
gattttgaaggggaagaactgaatgtgacctttgctgaaggagtgaatgcttgccaagag
acttgtaccaagatgattcgctgtcagttttttacttactctttacgcccagaagactgt
agaggagagaagtgcaagtgttccttacgattatctttggatggttccccaactgggatg
acatatgggacacgagtgagctctggttattctttgaggttgtgtaaaagtggggacagt
tctgtctgcacaacaaaaacgagcacacgcattgttggaggaaccaactcttcttgggga
gagtggccctggcaggtcagcctgcaagtgaagctgagagctcagagccacttgtgtgga
gggtcaatcattggacgccagtgggtcctcactgctgcccattgctttgatgaactctcc
ttgccagatgtttggcgcatttatagtggcattttaaatctgtcagagattacaaaagaa
acacctttctcgcaaataaaagagattatcattcaccaaaattacaaaatcacagacggt
ggtagttacgatattgccttaataaaacttgaggctcctttgaattatacagaattccaa
aaaccaatatgcctcccttccaaagatgatacaaatacaacttatactaattgctgggta
actggatggggcttcacaaaagaaagaggggaaatccaaaatagcctacaaaaggcaaat
attcctttggtaccaaatgaagaatgccagaaaaaatatagagattatgaagtaaacaaa
cagatgatctgtgctggctataaagaaggagggaaagatgcctgcaagggagattcaggt
ggtcccttagtttgtaaacacaacggaaactggcatttggtgggcatcaccagttggggt
gaaggctgtggccgcagagaacaaccaggtgtctacaccaaagtggctgagtatgtggac
tggattttagagaaaacacaggttggtgatgggcacgccggtcttggatga

DBGET integrated database retrieval system