KEGG   Canis familiaris (dog): 475684Help
Entry
475684            CDS       T01007                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1 isoform X1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04915  Estrogen signaling pathway
cfa04919  Thyroid hormone signaling pathway
cfa05200  Pathways in cancer
cfa05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    475684 (NCOA1)
   04919 Thyroid hormone signaling pathway
    475684 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    475684 (NCOA1)
   05224 Breast cancer
    475684 (NCOA1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     475684 (NCOA1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    475684 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 475684
NCBI-ProteinID: XP_005630255
Ensembl: ENSCAFG00000004075
VGNC: 43659
Position
17
AA seq 1440 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNSSISPAHGVARSSTLPPSSNNMVSPRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLAPRPRMPNNSFPPNIPTLSSPVSMTGTACNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSTDGKPLDSGLLHNNDRLSEGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
SGTSNSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDGASTSVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCTTNPTPMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCEPERMDGAV
TNVTIKSETLPASLQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPSYGTNPGTPPASTSPFSQLAANPESTLAN
RNSMVNRGMAGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFAPSLSPGNSMVPMPI
PPPQSSLLQPTPPSSGYQSPDMKAWQPGAMGNNVFSQAVQNQPTPAQPGVYNNMSITVSM
AGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTET
DGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLTE
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagattcacataagaggaaa
ggatcgccatgtgacactctggcatcaagcactgaaaagagacgcagggagcaagaaaat
aaatatttagaagagctagctgagttactatctgccaacatcagtgacattgacagtttg
agtgtaaaaccagacaaatgcaagattttgaagaagacagtcgatcagatacagttaatg
aagagaatggaacaagagaaatccacaactgatgatgaagtgcagaaatcagacatctca
tcgagcagtcagggagtgatagaaaaggagtccctgggacctctcctgttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtaggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcactgagaaccaagaagcttgccagcggtacgaagtc
atgcagtgtttcaccgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagctccctg
agagctgctggaagaactggctgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctccgtcaattctagtatctcgccagctcatggtgtg
gcccgttcatccacattgccaccatccagcaacaacatggtgtcccccagagtaaaccgc
caacagagctcagacctccatagcagcagtcatagtaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaacccctctttaaacctcaataattctcctatggaaggtacagga
atatctctcgcacagttcatgtctccaaggagacaagttagttctggattagcaccaagg
cccaggatgccaaacaattcgttccctcctaatattccgacattaagctcccccgttagc
atgacaggtactgcctgtaataatagtaaccgatcctattcaaacatcccagtaacatct
ttacagagcatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcaggttaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctactgatggcaaacctctggattctgggcttctgcataacaatgacagactctca
gaaggagacaataagtactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gcagagcagcagttacggcatgctgatatagacacaagttgcaaagaagtactgtcatgc
tcaggcacttccaactctgcctctgctaactcttcaagcggttcttgcccctcctctcat
agctcgctgacggagcggcacaaaattttgcaccggctcctacaggagggtagcccctcg
gatatcaccactttgtctgttgagcctgataaaaaggacggtgcatctacttctgtatca
gtgactggacaggtacaagggaactcgagtgtaaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgatatcttttagataaagatgagaaagattta
agatcaactccgaacctgagcctggatgatgtaaaggtgaaagtagaaaagaaagaacag
atggatccttgtaccacaaacccaaccccaatgaccaaacctgctcctgaagaaattaaa
ctggagtcccagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggcagcccagttgccaggcttatgtgagccagagaggatggatggtgcggtc
accaatgtaaccatcaaatcggagaccctgccagcttcacttcagtccaccactgccaga
cccacttccaggctaaataggttaccagagctggaattagaagcaattgacaatcagttt
ggacagccaggaacaggtgatcagattccatgggcaaataatacagtgactgctgtaaat
cagaataaaccagaagaccaatgtattagttcacaattagatgagctcctctgtccacca
acaacggtagaaggaagaaatgacgagaaggctcttcttgaacagctagtgtcctttctc
agcggcaaagatgaaactgaactagctgaactagatagagctctgggaattgacaaactc
gtccagggaggtggattagatgtcttatcagagagatttccaccacaacaagcaacacca
cctttaatgatggaagaaagacccaacctttattcccagccttattcttctccttcacct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgtccaagtgacacctccccgaggcgctttttcacctggcatgggcatgcagccc
cggcagactctgaacagacctccagccgcacccaaccagctgcggcttcagcttcagcag
cgcttgcaggggcaacagcagttgatccaccaaaatcgccaagctatcttgaaccagttt
gcagcaaacgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccaaatgttggcacaacgccagcgggagttgtacagccagcag
caccgacagagacagctaattcagcagcaaagagccatgctgatgaggcagcaaagcttt
ggaaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccgcagcaatttccctacccaccaagctatggtacaaacccaggaacccca
cctgcttcaaccagcccattttcacaactggcggcaaatcctgagtcaaccttggccaac
cgcaacagcatggtgaacagaggcatggcaggaaacatgggaggacaatttggcactgga
atcaatcctcagatgcagcaaaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggaactccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagccaactccaccctcttctgggtaccagtcacca
gacatgaaggcctggcagccaggagcaatgggaaacaatgtgttcagtcaagctgtccag
aaccagcccacacctgcgcagccaggagtgtacaacaatatgagcatcaccgtgtccatg
gcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatgagc
tctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatccagcactg
agacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaaaca
gatggaacccagcaggtgcagcaggttcaggtgtttgctgacgtccagtgtacagtgaat
ctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaacccaca
gcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgactgaa
taa

DBGET integrated database retrieval system