KEGG   Canis familiaris (dog): 475982Help
Entry
475982            CDS       T01007                                 

Gene name
MADD
Definition
(RefSeq) MAP kinase-activating death domain protein isoform X4
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: DENN uDENN
Motif
Other DBs
NCBI-GeneID: 475982
NCBI-ProteinID: XP_005631298
Ensembl: ENSCAFG00000008656
VGNC: 42917
UniProt: E2QTJ4
Position
18
AA seq 1648 aa AA seqDB search
MVQKKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHAEFPLPPDVVFFCQPEG
CLSVRQRRMSLRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRMPKDKGDGGAGSRGKE
GPRATCAPEEIGTESSESGLSLQPPSADSAPPNVTQSPRGKPRAKTGSRSRNSTLTSLCV
LSHYPFFSTFRECLYTLKRLVDCCSERLLGKKLGIPRGIQRDTMWRIFTGSLLVEEKSSA
LLHDLREIEAWIYRLLRSPVPVSGQKRVDIEVLPQELQQALTFALPDPSRFTLVDFPLHL
PLELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTC
MASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLDSNRVIAPTNAEVLPILPEP
ESLELKKHLKQALASMSLNTQPILNLEKFHEGQEIPLLLGRPSNDLQSTPSTEFNPLIYG
NDVDSVDVATRVAMVRFFNSPNVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFA
EKLARTQAVEYFGEWILNPTNYAFQRIHNNMFDPALIGDKPKWYAHQLQPIHYRVYDSNS
QLAEALSVPPERDSDSDPTDDSGSDSMDYDDSSSSYSSLGDFVSEMMKCDINGDTPNVDP
LTHAALGDASEVEIDELQNQKESEEPGPDSENSQENLPLRSSSSTTASSSPSTVIHGANS
EPADSTEVDDKAAVGVSKPPPTVPPSIGKSNVDRRQTEIGEGSVRRRTYDNPYFEPQYGF
PPEEEDDEQGESYTPRFSQHVNGNRAQKMLRPNSLKLASDSDAESDSRASSPTSTVSNTS
TEGFGGIMSFASSLYRNHSTSFSLSNLTLPTKGAREKTTPFPSLKVFGLNTLMEIVTEAG
PGSGEGNRRALVDQKSSVIKHSPTVKREPPSPQGRSSNSSENQQFLKEVVHSVLDGQGVG
WLNMKKVRRLLESEQLRVFVLSKLNRTVQSEDDARQDVIPDVEISRKVYKGMLDLLKCTV
LSLEQSYAHAGLGGMASIFGLLEIAQTHYYSKEPDKRKRSPTESVNTPVGKDPGLAGRGD
PKAMAQLRVPQLGPRAPSAAGKGPKELDTRSLKEENFVASVELWNKHQEVKKQKALEKQR
PEVIKPVFDLGETEEKKSQISADSGVSLTSGSQRTDTDSVIGVSPAVMIRSSSQDSEVST
VVSNSSGETLGADSDLSSNAGDGPGGEGSAHLASSRGTLSDSEIETNSATSTIFGKAHSL
KPSVKEKLVGSPVRSSEDVSQRVYLYEGLLGRDKGSMWDQLEDAAMETFSISKERSTLWD
QMQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLI
SYMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLVNLNGRDLSIRSSGSRHMK
KQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWR
RNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDMKTGEGGLL
QVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICY
SVLCLFSYVAAVRSSEEDLRTPPRPVSS
NT seq 4947 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaagaagaagttctgtcctcggttacttgactatctcgtgatcgtaggggcc
aggcacccaagcagtgatagtgtggcccagactcctgaattattacggcgctatccactg
gaggaccacgctgagtttcccctgcccccagatgtagtgttcttctgccaaccagagggc
tgtctgagtgtgcggcagcggcgcatgagcctgcgggatgatacttcttttgtcttcacc
ctcactgacaaggacactggagtcactcgttatggcatctgtgttaacttctaccgctcc
ttccagaagcgtatgcctaaggacaagggggatgggggggcagggtcccgtgggaaggaa
ggaccccgtgctacttgtgccccagaagagattggcactgagagctcagagagtggcttg
tccctgcagcctcccagtgctgactctgccccccctaatgtgactcagtctcctcggggc
aaaccccgggccaagacgggaagccgctcccgcaatagtactctgacatccttgtgcgtg
ctcagccactatcccttcttctccaccttccgagaatgtctgtacaccctcaaacgtctg
gtggattgctgcagtgagcggctgctgggcaagaaactaggcatccctcgaggtatacaa
agggacactatgtggcgcatctttactggatcattgctagtggaggagaagtcaagtgcc
cttcttcatgaccttcgagagatcgaggcctggatctatcgattgctacgctccccagtg
cctgtctctgggcagaagcgagtggacattgaggtcctaccccaggagctccaacaagct
ctgacctttgctcttccagacccttctcgattcaccctagtggatttcccactgcacctt
cccttggaacttctgggtgtggatgcctgtctccaggtgctaacctgcatcctgttagag
cacaaggtggtgctacagtcccgagactacaatgccctctccatgtctgtgatggcgttt
gtggcaatgatctacccactggagtatatgtttcctgtaatcccactgctgcccacctgc
atggcatcggcagaacagctgctgttagctccaactccgtacatcatcggggtccctgcc
agcttcttcctctacaaactggacttcaaaatgcctgatgatgtatggctggtggatctg
gacagcaatagggtgattgcccccaccaatgcagaagtgctaccaatcctgccagaaccg
gaatcattggagctgaaaaagcatttgaagcaggcccttgccagcatgagtctcaacacc
cagcccatcctcaatctggagaaattccatgaaggccaagagatcccccttctcttgggt
aggccttctaacgacttgcagtccacaccttccactgaattcaacccactcatctatggc
aatgatgtagattctgtggatgttgcaaccagagtggccatggtccgtttcttcaactcc
cccaacgtgctgcagggctttcagatgcacacacgtaccctgcgtctcttcccgcggcct
gtggtagcttttcaagctggctcctttctagcctcacgtccccggcagactccttttgct
gagaaactggccaggacacaggctgtggagtactttggagaatggatccttaaccccacc
aactatgccttccagcgaattcacaacaacatgtttgatccagccctgattggtgacaag
ccaaagtggtatgctcatcagctgcagcctatccattatcgagtctatgatagcaattcc
cagctggcggaggcactgagtgtgccaccagagcgtgactctgactctgaccctactgat
gacagtggcagtgatagtatggattatgatgactcaagctcttcctactcctcccttggt
gactttgtcagtgaaatgatgaaatgtgacatcaatggtgatactcccaatgtggatcca
ttgacacacgcagccctgggggatgccagtgaagtggagattgatgagctgcaaaaccag
aaggaatcagaggaacctggcccagacagtgagaactctcaggaaaacctgccactgcgc
tccagctccagcaccactgccagcagtagccccagcactgtcatccatggagctaattct
gaacctgccgactcaacggaggtggacgataaggcagcagtaggtgtctccaagcccccc
cccacagtgcctcccagcattggcaagtcgaacgtggacaggcgtcagacagaaattgga
gaggggtcagtgcgccggcgaacctatgacaatccatacttcgagccccaatatggcttt
ccccctgaggaggaggatgatgagcagggggaaagttacactccccgattcagccaacat
gtcaatggcaatcgggctcaaaagatgctgcggcccaacagcttgaaactggcaagcgac
tcagacgcagagtcagactctcgagcgagctctcccacctccaccgtctccaacaccagc
accgagggcttcgggggcatcatgtcttttgccagcagcctgtatcgaaaccacagtaca
agcttcagtctttcaaacctcacactgccgaccaaaggtgcccgagagaagacgaccccc
ttccccagtctgaaagtatttgggctaaatactctaatggagattgttactgaagccggc
cccgggagtggtgaaggaaacaggagggccttagtggaccagaagtcatctgttattaaa
cacagcccaacagtgaaaagagagcctccatcacctcagggtcgatccagcaattctagt
gagaaccagcagttcctgaaggaagtggtacacagcgtgctggatggccagggtgttggc
tggctcaacatgaaaaaggtgcgtcggctgctggagagtgagcagctgcgagtctttgtc
ctgagcaagctgaaccgaactgtgcagtcagaagatgatgcccggcaggacgtcatcccc
gatgtggagatcagcagaaaggtttacaaggggatgttagacctgctcaagtgcacagta
ctcagcctggagcagtcctatgcccacgcaggtctgggtggcatggccagcatctttggg
cttctggagattgcccagacccactactatagtaaagaaccagacaagcggaagagaagt
ccaacagagagtgtaaatacaccagttggcaaggatcctggcctggctgggcggggggac
ccaaaagctatggcacagctgagagttccccagctgggccctcgggcgccaagtgctgca
ggaaagggtcccaaagaactagacaccagaagtttaaaggaagagaattttgtagcatct
gttgaattgtggaacaagcaccaggaagtgaaaaagcaaaaagctttggaaaaacagagg
cctgaagtcatcaaacccgtctttgaccttggtgagacagaggagaaaaagtcccagatc
agcgcagacagtggtgtgagcctgacatctggttcccagaggactgatacagactctgtc
attggtgtgagtccagctgttatgatccgaagctcaagtcaggactctgaagttagcacc
gtggtgagtaatagttctggagagacccttggagcagatagtgacctgagcagcaatgca
ggtgatggaccaggtggtgaaggcagcgcccacttggcaagctctcggggcactttgtct
gatagtgaaattgagaccaattctgctaccagcaccatctttgggaaagcccatagcttg
aagccaagtgtaaaggagaagctggtgggcagcccagttcgctcttccgaagatgtaagc
caacgggtctatctgtacgagggactcctaggaagggacaaaggatcgatgtgggaccag
ttagaggatgcggctatggagaccttttctataagcaaagaacgttctactttgtgggac
caaatgcagttctgggaagatgcattcttagatgctgtgatgttggagagagaagggatg
ggtatggaccagggtccccaggaaatgatcgacaggtacctgtccctgggagaacatgac
cggaagcgcctagaggatgatgaagatcgtttgctggccacacttttgcacaacctcatc
tcctacatgctgctgatgaaggtaaataagaatgacatccggaagaaggtgaggcgccta
atgggaaagtcccatattgggcttgtgtacagccagcaaatcaatgaagtgcttgatcag
ctggtgaacctgaatggacgtgatctctctatccggtccagtggcagccggcacatgaaa
aagcagacatttgtggtacatgcagggacagacacaaatggagacatcttcttcatggag
gtgtgtgatgactgtgtggtgttacgtagtaacatcggaacggtgtatgagcgctggtgg
tatgagaagctcatcaacatgacctactgtcccaagaccaaggtgttgtgcttgtggcgt
agaaatggctctgagactcagctcaacaaattctatactaagaagtgtcgggagctgtac
tactgtgtgaaggacagcatggagcgggctgctgcccggcagcaaagcatcaaacctggc
cctgaactgggtggcgagttccctgtgcaggacatgaagactggtgagggtggcttgctg
caggtcaccctagaagggatcaatctcaagttcatgcacaaccaggttttcatagagctg
aatcacattaaaaagtgcaatacagtccgaggcgtctttgtcctggaggaatttgttcct
gaaattaaagaagtggtgagccacaagtacaagacaccaatggcccatgagatctgctac
tctgtgttgtgtctcttctcgtatgtggctgcagttcgtagcagtgaggaagatctcagg
accccaccccggcccgtctcgagctga

DBGET integrated database retrieval system