KEGG   Canis familiaris (dog): 476008
Entry
476008            CDS       T01007                                 

Gene name
RBM4B
Definition
(RefSeq) RNA-binding protein 4B isoform X1
  KO
K13187  RNA-binding protein 4
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cfa03041]
    476008 (RBM4B)
Spliceosome [BR:cfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    476008 (RBM4B)
SSDB
Motif
Pfam: RRM_1 RRM_5 zf-CCHC RRM_occluded RRM_7 zf-CCHC_3 zf-CCHC_2 zf-CCHC_5
Other DBs
NCBI-GeneID: 476008
NCBI-ProteinID: XP_005631483
Ensembl: ENSCAFG00000012378
VGNC: 52038
UniProt: E2RSD7
Position
18
AA seq 359 aa
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRT
GRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASA
YNYAEQSMSHLPQVQSTAVTSHLNSTSVDPYDRHLLPNSGAAATSAAMAAAAANTSSYYG
RDRSPLRRAAAVLPTVGEGYGYGPESELSQASAAARNSLYDMARYEREQYVDRARYSAF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtgaagctgttcatcggaaacctgccccgggaggccacagagcaggagatccgctca
ctcttcgagcagtatgggaaggtgctggagtgtgacatcattaagaactatggctttgtg
cacatagaggacaagacggccgcggaggatgccatacgcaacctgcaccactacaagctg
cacggggtgaacatcaacgtggaagccagcaagaataagagcaaagcctcaaccaagtta
cacgtgggcaacatcagtcccacctgtacaaaccaagagcttcgggccaagtttgaggag
tatggtccagtcatcgaatgtgacatcgtgaaagattatgccttcgtacacatggagcgg
gcagaggatgcagtggaagccatcaggggccttgacaacacagagtttcaaggcaaaagg
atgcacgtgcagttatccacaagccgacttcggactgcccctgggatgggagaccagagt
ggctgctatcggtgtgggaaagaggggcactggtcaaaagagtgtccagtagatcgtaca
ggtcgtgtggcggactttaccgagcagtataacgaacagtatggagcagtgcgcacgcct
tacaccatgggctacggggaatccatgtattacaacgatgcgtatggagcactcgactac
tataagcgttaccgggtccgctcttatgaggcagtggcagcggcagcagcagcttctgcg
tacaactacgcggagcagtccatgtcccatctgcctcaagtccagagcacagctgtgacc
agtcacctcaactccacttctgttgatccctacgacagacacctgttgccgaactcaggt
gctgctgccacttcggctgctatggctgctgccgctgccaacacttcctcctattatgga
agggacaggagccccctgcgtcgtgctgcagctgtgctccccacagttggagagggctac
ggttatgggccagagagtgagctgtctcaggcttcagcagctgcacggaattctctatat
gacatggcccggtatgagcgggagcagtatgtggaccgagcgcggtactcagccttttaa

DBGET integrated database retrieval system