KEGG   Canis lupus familiaris (dog): 476027
Entry
476027            CDS       T01007                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00100  Steroid biosynthesis
cfa01100  Metabolic pathways
Module
cfa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    476027 (TM7SF2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     476027 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 476027
NCBI-ProteinID: XP_022261374
Ensembl: ENSCAFG00000013951
VGNC: 47413
Position
18
AA seq 403 aa
MASPQGSRAPLEFGGPLGAAALMLLLPATMFHLLLVVRSGPARLLGPPPYLPGLQVLWSP
RMLLLWLTWLGLQAALYLLPARKVAEGQELKDKSRLLYPINVLAGLPLGALPEMLLPLAF
AATFTTFIFSLFLYLKALVAPASALAPGGNSGNPIYDFFLGRELNPRVWSFDFKYFCELR
PGLIGWVLINLAMLMQEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGF
GFMLAFGDLAWVPFTYSLQAQFLLHHPQPLGLPVASVICLINAVGYYIFRGANSQKNTFR
KNPSDPRVADLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFY
LLYFTALLVHREARDEQQCLQKYGLAWHEYCRRVPYRILPYIY
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcctctcctcagggatcccgggctccgctggaattcgggggacccctgggcgcggcg
gcgctgatgctgctgctccctgccaccatgttccacctgctcttggtggtccgctcgggc
cccgcgcgcctcctgggcccacccccctacctgccgggactccaagtgctgtggagcccg
aggatgctactgctgtggctcacctggctcggcctgcaagcggctctctacctattgcct
gcgcgcaaggttgctgagggacaggaactgaaggacaagagtcgtctgctctatcccatt
aacgtgttggcaggtctgcctctgggggcgctccccgaaatgctcctgcccttggcattt
gcggccaccttcaccaccttcattttcagcctctttctctatctgaaggccctggtggcc
cctgcctcggccctggcacctggggggaactcaggcaatcccatttacgacttcttcctg
ggacgggagctcaacccgcgcgtctggtcctttgacttcaaatatttctgtgaactgcgg
cctggcctcatcggctgggtcctcatcaacctggccatgctgatgcaggaagcagaactt
cgggggagtccctcactggccatgtggctggtcaatggcttccagctactctatgtgggt
gatgctctctggcatgaggaagctgttctcaccaccatggacatcacacatgatgggttt
ggcttcatgctggcctttggggacctagcctgggtacccttcacttacagcctgcaggcc
caattcctgctgcaccacccacagcccctggggttgcctgtggcctcagtcatctgcctc
atcaatgctgttggttactacatcttccgaggagctaattcccagaagaacaccttccga
aagaatccttctgaccccagagtggctgaccttgagaccatccccacagccaccgggcga
cagctgctggtgtctgggtggtggggtatggtccgccatcccaactaccttggagacctc
atcatggctctggcctggtccttgccttgtggagtgtctcacctgctaccctacttctac
ctcctctacttcacggcactactggtacaccgtgaggctcgggatgagcagcagtgcctg
cagaagtatggcctggcctggcatgaatactgtcggcgtgtgccttaccgaatcctgccc
tacatctactga

DBGET integrated database retrieval system