KEGG   Canis familiaris (dog): 476034Help
Entry
476034            CDS       T01007                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00562  Inositol phosphate metabolism
cfa01100  Metabolic pathways
cfa04015  Rap1 signaling pathway
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04062  Chemokine signaling pathway
cfa04070  Phosphatidylinositol signaling system
cfa04071  Sphingolipid signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04310  Wnt signaling pathway
cfa04371  Apelin signaling pathway
cfa04540  Gap junction
cfa04611  Platelet activation
cfa04621  NOD-like receptor signaling pathway
cfa04713  Circadian entrainment
cfa04720  Long-term potentiation
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04728  Dopaminergic synapse
cfa04730  Long-term depression
cfa04750  Inflammatory mediator regulation of TRP channels
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04918  Thyroid hormone synthesis
cfa04919  Thyroid hormone signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04922  Glucagon signaling pathway
cfa04924  Renin secretion
cfa04925  Aldosterone synthesis and secretion
cfa04926  Relaxin signaling pathway
cfa04927  Cortisol synthesis and secretion
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04934  Cushing's syndrome
cfa04961  Endocrine and other factor-regulated calcium reabsorption
cfa04970  Salivary secretion
cfa04971  Gastric acid secretion
cfa04972  Pancreatic secretion
cfa05010  Alzheimer's disease
cfa05016  Huntington's disease
cfa05142  Chagas disease (American trypanosomiasis)
cfa05143  African trypanosomiasis
cfa05146  Amoebiasis
cfa05163  Human cytomegalovirus infection
cfa05200  Pathways in cancer
Module
cfa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    476034 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    476034 (PLCB3)
   04310 Wnt signaling pathway
    476034 (PLCB3)
   04371 Apelin signaling pathway
    476034 (PLCB3)
   04020 Calcium signaling pathway
    476034 (PLCB3)
   04070 Phosphatidylinositol signaling system
    476034 (PLCB3)
   04072 Phospholipase D signaling pathway
    476034 (PLCB3)
   04071 Sphingolipid signaling pathway
    476034 (PLCB3)
   04022 cGMP - PKG signaling pathway
    476034 (PLCB3)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    476034 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    476034 (PLCB3)
   04621 NOD-like receptor signaling pathway
    476034 (PLCB3)
   04062 Chemokine signaling pathway
    476034 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    476034 (PLCB3)
   04922 Glucagon signaling pathway
    476034 (PLCB3)
   04912 GnRH signaling pathway
    476034 (PLCB3)
   04915 Estrogen signaling pathway
    476034 (PLCB3)
   04921 Oxytocin signaling pathway
    476034 (PLCB3)
   04926 Relaxin signaling pathway
    476034 (PLCB3)
   04918 Thyroid hormone synthesis
    476034 (PLCB3)
   04919 Thyroid hormone signaling pathway
    476034 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    476034 (PLCB3)
   04916 Melanogenesis
    476034 (PLCB3)
   04924 Renin secretion
    476034 (PLCB3)
   04925 Aldosterone synthesis and secretion
    476034 (PLCB3)
   04927 Cortisol synthesis and secretion
    476034 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    476034 (PLCB3)
   04270 Vascular smooth muscle contraction
    476034 (PLCB3)
  Digestive system
   04970 Salivary secretion
    476034 (PLCB3)
   04971 Gastric acid secretion
    476034 (PLCB3)
   04972 Pancreatic secretion
    476034 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    476034 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    476034 (PLCB3)
   04725 Cholinergic synapse
    476034 (PLCB3)
   04728 Dopaminergic synapse
    476034 (PLCB3)
   04726 Serotonergic synapse
    476034 (PLCB3)
   04720 Long-term potentiation
    476034 (PLCB3)
   04730 Long-term depression
    476034 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    476034 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    476034 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    476034 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    476034 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    476034 (PLCB3)
   05016 Huntington's disease
    476034 (PLCB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    476034 (PLCB3)
   04934 Cushing's syndrome
    476034 (PLCB3)
  Infectious diseases
   05163 Human cytomegalovirus infection
    476034 (PLCB3)
   05146 Amoebiasis
    476034 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    476034 (PLCB3)
   05143 African trypanosomiasis
    476034 (PLCB3)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     476034 (PLCB3)
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    476034 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    476034 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Motif
Other DBs
NCBI-GeneID: 476034
NCBI-ProteinID: XP_853283
Ensembl: ENSCAFG00000014542
VGNC: 52035
UniProt: J9JHK9
Position
18
AA seq 1230 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYSRLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNS
SVRKRPLEQSNSALSESSATTDPSSPQLGSPSSESCPGLSNGEEVGLEKPSLEPQKSLGE
DGLPRGPNTLGSADREDEEEEEEEEEQADPKKPTSDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASPETCQETPSQQP
GSQLTPNPTPSPLDTPPRRPPGPATAPTSPSLSSPGQRDDLIASLLSEVAPIPLEELRGH
KALVKLQNRQERELRELHKKHQRKAVALTRRLLEGLAQARAESRCRHRPGVLGGENEKEE
GEEVKRYQEFQKRQVQSLLELREAQVDTEAERRLEHLRQAQQRLREVVLDAHTTQFKKLK
EINEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQK
QRQERLVAGQQQVLQQLAEEEPKLLAQLAQECQEHRARLPQEIRQSLLGETPEGLGDRHL
VACASNGHAPGSSGHLSGADSESQEENTKL
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagcaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtaaccctgcgtgtggattccaatggcttctttctatactggactggacccaacatggag
gtggacacactggacattagttccatcagggacacgcgaacaggtcgttactcccgcctg
ccaaaggaccccaagatccgggaggtgctgggctttgggggccctgatacccgactagag
gagaagttgatgacggtggtggccgggccagacccggtgaatacaacattcttgaacttc
atggctgtgcaggatgacacagccaaggtctgggccgaggagctgttcaagctggctatg
aacatcctggcccagaacgcctccaggaataccttcctgcggaaagcatacaccaagctg
aagctgcaggtgaaccaggatggacggatcccggttaagaatatcctgaagatgttttca
gcagataaaaagcgagtggagaccgcactagaatcctgtggcctcaatttcaaccggagt
gaatccatccggcccgatgagttttccttggaaatctttgagcggttcctgaataagttg
tgtctgcggccggacattgacaagatcctgctagagataggtgctaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgggacccgaggctcaac
gaagtgctgtacccacccctgcggccctcccaggctcggctgctcattgagaagtatgag
cccaaccagcagttcctggagcgagatcagatgtccatggagggcttcagccgctacctg
ggaggtgaagagaatgggatcctgcccctggaggccctggatctgagcgctgacatgacc
cagccactcagtgcctatttcatcaactcctcacacaacacctatctcacagcggggcag
ctggctgggacctcgtcggtggagatgtaccggcaggcgctgctgtggggctgccgctgt
gtggagctggatgtgtggaaagggcggccgccggaggaggagcccttcatcacccacggc
ttcaccatgaccactgaggtgccgctgagagacgtgctcgaggccattgcagaaaccgcc
ttcaagacctcaccctatccagtcatcctctccttcgagaatcacgtggactcagcgaag
cagcaggccaagatggccgagtactgccgttccatctttggggacgcgctgctcatcgac
ccactggacaagtacccgctggccccaggtgtccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcgacaccagcccagcactggtgtccccaacagc
tctgtgcgcaagcggccgctggagcagagcaactcggccctgagcgagagctctgccacc
actgacccctcctcacctcagcttgggtcccccagctctgagagctgcccaggcctgagc
aatggggaagaggtgggcctggagaagcctagcctggagcctcagaagtctctaggcgag
gatgggctcccacggggccccaacactcttggatctgctgaccgtgaggatgaggaagaa
gaggaggaagaggaggaacaggcagatcctaaaaagccaacctcagatgagggcactgcc
agcagtgaggtcaatgccactgaggaaatgtcaacactcgtcaactacattgagcctgtc
aagttcaagtcctttgaggctgctcgaaaaaggaacaaatgctttgagatgtcatccttc
gtcgaaaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaat
aaacagcagctcagccgcatctaccctaagggtacccgcgtggactcatccaactacatg
ccccagctcttttggaacgtgggctgccagcttgttgcactcaacttccagaccctggat
gtggcaatgcagctcaacgcaggcgtgttcgagtacaatgggcgcagtggctatctgctc
aaacctgagtttatgcggcggccagacaagtccttcgatcctttcaccgaagtcattgtg
gatggcattgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggcatctatgtggaggtggacatgtttggcctccccgttgacacgcggcgc
aagtaccgtactcggacctctcaagggaactcattcaaccctgtgtgggatgaggaacct
tttgacttccccaaggtggtgctacccacgctggcttcgctgcgcatcgcggcctttgag
gaaggcggcaagtttgtggggcatcggattctgcccgtctctgccatccgctcagggtac
cactacatctgtctgcggaacgaggccaaccagccactttgcctgccagccctgctcatc
tacactgaagcctccgactatattcctgatgaccaccaggactacgcagaggccctgatc
aaccccatcaagcatgtcagcctgatggaccagagggccaagcagttggccgccctcatt
ggggagagtgaggctcaggccagcccagagacatgccaggagactccgtctcagcagccg
gggtcccagctgaccccaaaccctacacctagccccctggacacacccccgcgccggccc
ccaggccctgccacagcccctaccagcccctccctcagcagcccagggcagcgggatgac
ctcatcgccagcctcctctcagaggtggccccaatcccgctggaggagctccgaggccat
aaggcgctggtgaagctccagaaccggcaagaacgagagctgcgggagctacataagaag
caccagcggaaggccgtcgccctcacccgccggctgcttgagggcctggctcaggcccgg
gcggagagcaggtgccggcatcggccaggtgtcctaggcggggagaacgagaaggaagag
ggagaagaggtaaagcggtatcaggagttccagaagagacaggtgcagagtctgttggag
ctacgggaggctcaggtggacacagaggccgagcggaggctggagcacctgagacaggct
cagcagcggctcagggaagttgtcctggatgctcacacaactcagttcaagaagctgaag
gagataaatgagagggagaagaaggaattgcagaagattttagacaggaagcgccacaac
agtatctcagaggccaagactagggagaaacataagaaggaggcggaactgacagagatt
aaccgtcggcacatcactgagtcggtcaactccatccgtcggctggaggaggcccagaag
cagcggcaggaacgcctggtggctgggcagcagcaggtcctacagcagctggctgaagag
gagcccaagctgctggcccagctggcccaggagtgtcaggaacatcgagcaaggctgccc
caggagatccgccagagcctgctgggcgagacaccggaggggctgggggacaggcacctg
gtggcctgtgccagcaacggtcacgcacctgggagcagcgggcacctgtctggcgctgac
tcagagagccaagaggagaatacgaagctctga

DBGET integrated database retrieval system