KEGG   Canis lupus familiaris (dog): 476052
Entry
476052            CDS       T01007                                 

Gene name
POLR2G
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB7
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa03020  RNA polymerase
cfa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    476052 (POLR2G)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    476052 (POLR2G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    476052 (POLR2G)
   03019 Messenger RNA biogenesis [BR:cfa03019]
    476052 (POLR2G)
   03400 DNA repair and recombination proteins [BR:cfa03400]
    476052 (POLR2G)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     476052 (POLR2G)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     476052 (POLR2G)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      476052 (POLR2G)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 476052
NCBI-ProteinID: XP_533260
UniProt: F1PT38
Position
18
AA seq 172 aa
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttctatcacatctccctggagcacgagatcctgctgcacccgcgctatttcggcccc
aacctgctcaacacggtcaagcagaagctcttcaccgaggtggaggggacctgcaccggc
aagtatggctttgtaattgctgtcaccaccattgacaatattggtgctggtgtgatccag
ccaggccgagggtttgtcctttatccagttaagtacaaggccattgttttccggcccttt
aaaggggaggtcgtggatgctgttgtcactcaagtcaacaaggttggacttttcacagaa
attggaccaatgtcctgcttcatttctcgacattccatcccatcagagatggagtttgac
cccaactccaacccaccatgttataagacaatggatgaggacattgtgattcagcaggat
gatgagatccgcttgaagattgtggggacccgtgtggacaagaatgacatttttgctatt
ggctctctgatggacgattacttggggcttgtgagctga

DBGET integrated database retrieval system