KEGG   Canis lupus familiaris (dog): 476147
Entry
476147            CDS       T01007                                 

Gene name
TNFAIP6
Definition
(RefSeq) tumor necrosis factor-inducible gene 6 protein
  KO
K19018  tumor necrosis factor-inducible gene 6 protein
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    476147 (TNFAIP6)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   476147 (TNFAIP6)
SSDB
Motif
Pfam: CUB Xlink CUB_2
Other DBs
NCBI-GeneID: 476147
NCBI-ProteinID: XP_533354
Ensembl: ENSCAFG00000005660
VGNC: 47651
UniProt: E2R939
Position
19
AA seq 277 aa
MIIFISLFVLLWEEAHGWGFNNGIFHNSIWLEQAAGVYHREARSGRYRLTYAEAKAVCEF
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQICYWHIRVKYGQRVHLSFLDF
DLEDDPACLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYIAVDPLSKSSQGKNTSTTSTGNKNFLAGRFSHL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgatcatctttatttccttatttgtcttgctgtgggaagaggcgcacggatggggattc
aacaatgggatttttcataactctatatggcttgaacaggcagctggcgtgtaccaccgg
gaagctcgctcgggccgctacaggctcacgtacgccgaggccaaggccgtgtgcgagttc
gagggcggccggctcgccacctacaagcagctggaggcggcccgcaaaatcggatttcac
gtctgcgctgctgggtggatggccaagggcagagttggataccccattgtgaaaccgggg
cccaactgtggatttggaaaaactggtattattgattatggagtccgtcttaataggagt
gaaagatgggatgcctattgctacaacccacatgcaaaggagtgtggtggagtctttaca
gatccaaagcgaatttttaaatctccaggcttcccaaatgagtatgatgataaccagatc
tgctactggcacattagagtcaagtatggtcagcgtgttcacctgagctttctggacttt
gaccttgaggatgacccagcctgcttggctgactatgttgaaatatatgacagttacgat
gacgtccacggttttgtgggaaggtactgtggagatgagcttccagaagacatcattagt
acaggaaatgtcatgaccttgaagtttctaagtgacgcttcagtgacagcgggaggtttc
caaatcaagtacattgcagtggatcctctatccaaatccagtcaaggaaaaaacacaagc
actacttctactggaaataagaactttttagctggaagatttagccatttataa

DBGET integrated database retrieval system