KEGG   Canis familiaris (dog): 476176Help
Entry
476176            CDS       T01007                                 

Gene name
TMX3
Definition
(RefSeq) protein disulfide-isomerase TMX3 isoform X2
  KO
K09585  thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     476176 (TMX3)
Chaperones and folding catalysts [BR:cfa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   476176 (TMX3)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    476176 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_6 Calsequestrin Thioredoxin_7
Motif
Other DBs
NCBI-GeneID: 476176
NCBI-ProteinID: XP_022269208
Ensembl: ENSCAFG00000000043
VGNC: 47644
UniProt: F1PIX5
Position
1
AA seq 227 aa AA seqDB search
MAAGTLGAGMRLCATVFLLDMAFSKGFVQDLDESFKDNRKDDIWLVDFYAPWCGHCKKLE
PIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKD
DIIEFAHRVSGALIRPLPSQQMFEHVQKRHRVFFVYIGGESPLKEKYIDAASELIVYTYF
FSASEEVVPEYVTLKEMPAVLVFKDETYFIYDDMPSLECTRRWVKYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgggacgctcggggccggcatgcggctctgcgccacagtttttttattggat
atggctttcagtaaaggatttgtacaagatttggatgaatcgtttaaagataatcggaaa
gatgacatttggcttgtagatttttatgcaccatggtgtggccattgtaaaaaactggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggttctccagttaaagttgga
aagatggatgctacttcctattctagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaagggggacttggcatataattatagaggaccacgaactaaagat
gatattattgagtttgctcacagagtgtctggggctctaattcggccgcttccaagtcag
caaatgtttgaacatgtgcaaaagagacatcgtgtattttttgtttacattggtggagag
tcaccgttgaaggagaaatacatagatgctgcttcagaattaattgtatatacatacttc
ttttctgcctcagaagaagtggttcctgagtatgtgacactgaaggagatgccagctgtg
cttgttttcaaagatgaaacttactttatttatgatgatatgccctccctcgagtgcaca
agaagatgggtgaagtatctgtag

DBGET integrated database retrieval system