KEGG   Canis lupus familiaris (dog): 476190
Entry
476190            CDS       T01007                                 

Gene name
ATP8B1
Definition
(RefSeq) phospholipid-transporting ATPase IC isoform X2
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    476190 (ATP8B1)
Enzymes [BR:cfa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     476190 (ATP8B1)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3 DUF98
Other DBs
NCBI-GeneID: 476190
NCBI-ProteinID: XP_013964629
Ensembl: ENSCAFG00000000123
VGNC: 38288
UniProt: E2QV99
Position
1
AA seq 1250 aa
MNSERDSETTFEEDSQPNDEVVPYSDDETEDELEDQGPAVEPEQNRVNREAEEQREPPRK
DCTWQVKANDRSFHEQPHFMNTKFFCIKESKYANNAIKTYKYNAFSFLPMNLFEQFKRAA
NFYFLILLILQAIPQISTLAWYTTLFPLLVVLGITAMKDLVDDVARHKMDNEINNRTCEV
IKDGRFKVTKWKEIQVGDIIRLKKNDFIPADILLLSSSEPNSLCYVETAELDGETNLKFK
MALEITHQYLQRENALTTFDGFIECEEPNNRLDKFTGTLFWRNTSFPLDADKILLRGCVI
RNTDFCHGMVIFAGADTKIMKNSGKTRFKRTKIDYLMNYMVYTIFVVLILVSAGLAIGHA
YWEAQIGNNSWYLYDGEDYTPSYRGFLNFWGYIIILNTMVPISLYVSVEVIRLGQSYFIN
WDLQMYYPDKDTPAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCINGQIYGDHR
DASQNNHSKIEPVDFSWNMFADGKLAFYDHYLIEQIHSGKESEVRQFFFLLAVCHTVMVD
RIDGQLNYQAASPDEGALVSAARNFGFAFLARTQNTITISELGTERTYDVLAILDFNSDR
KRMSIIVRTPEGNIRLYCKGADTVIYERLHQMSPTKQETQDALDIFASETLRTLCLCYKE
IEEKEYEEWNKKFMAASIASTNRDEALDKVYEEIEKDLILLGATAIEDKLQDGVPETISK
LAKADIKIWVLTGDKKETAENIGFACELLTEDTTICYGEDINALLHTRMENQRNRGGVYA
KFAPPVHEPFFPSGENRALIITGSWLNEILLEKKTKRSKILKLKFPRTEEERRMRTQSKR
RLEARKEQRQKNFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNM
IKTAHIGVGISGQEGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFA
FTLVHFWYSFFNGYSAQTAYEDWFITLYNVLYSSLPVLLMGLLDQDVSDKLSLRFPGLYV
VGQRDLLFNYKKFFVSLVHGILTSMILFFIPLGAYLQTVGQDGEAPSDYQSFAVTIASAL
IITVNFQIGLDTSYWTFVNAFSIFGSIALYFGIMFDFHSAGIHVLFPSAFQFTGTASNAL
RQPYIWLTIILTVAVCLLPVVAIRFLSMTIWPSESDKIQKHRKRLKAEEQWKRRQVFRRG
VSSRRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIIADGTAEYRRTVES
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgaattcagaaagagactcagagacaacctttgaggaggattctcagcccaatgacgag
gtggttccctacagtgatgatgaaacagaagacgagctggaagaccaaggccctgcagtt
gagccagaacagaaccgagtcaacagagaggcagaggagcagcgggagccaccccggaaa
gattgtacgtggcaagtcaaagctaatgatcgaagcttccacgaacagcctcactttatg
aacactaagttcttttgtattaaggagagcaagtatgcgaataatgcaattaaaacatac
aagtataatgcattttcctttctaccaatgaatttgtttgaacagtttaagagagcagcc
aatttctatttcctgatccttcttatcttacaggcaatccctcaaatctcgaccctggct
tggtacaccaccctgtttcccttgctcgtggtgctgggcatcacggccatgaaggacctg
gtggacgatgtggctcgccataaaatggataatgaaatcaataacaggacgtgtgaagtc
attaaggatggcagattcaaagttaccaagtggaaagagattcaagttggagatatcatt
cgtctgaaaaaaaatgattttattccagctgacatcctgctactgtccagctctgagcct
aacagcctctgctatgtcgaaacagctgaactggatggagaaaccaatctaaagttcaaa
atggcgcttgaaatcacacaccagtatctccaaagagaaaatgcattgacaacatttgat
ggttttattgaatgtgaagaacccaataatcgactagataagtttacaggaacattattt
tggagaaacacaagttttcctctggatgccgataaaattttgttacgtggctgtgtaatt
aggaacactgacttctgccatgggatggtcatttttgcaggtgctgacactaaaataatg
aagaatagtgggaaaaccagatttaaaagaactaaaattgattacttgatgaactacatg
gtttatacgatctttgttgttctcatcctggtgtctgcgggtcttgccatcggccatgct
tactgggaagctcaaattggcaataattcttggtacctctacgatggagaagactataca
ccctcctaccgtggattcctaaatttctggggctacatcattattctaaacaccatggtg
cccatctctctctatgtcagtgtggaagtgatccgtcttggacagagttacttcataaac
tgggacctgcagatgtactatcctgacaaggacacgcccgccaaggcgagaaccaccaca
ctgaatgagcagctggggcagatccattacattttctctgataagacagggacactcaca
caaaacatcatgacgtttaagaagtgctgcatcaatgggcagatatatggagaccatcga
gatgcttctcaaaacaaccacagcaaaatagagcccgttgattttagctggaacatgttt
gctgatgggaagcttgcgttttatgaccactatcttattgagcaaatccactcagggaaa
gagtcggaagttcgacagtttttcttcctgcttgcagtttgccacacggtcatggtggat
agaattgatggtcagctcaactaccaggcagcctctcccgacgaaggcgccctagtgagc
gctgccaggaactttggctttgccttccttgcgaggacccagaacacgatcaccatcagt
gagttggggaccgaaaggacctacgacgttcttgccatcttggacttcaacagcgaccgg
aagcgaatgtctataatcgtaagaaccccagaaggcaacatcaggctttattgtaaaggt
gctgacacagtgatttatgaacggttacatcagatgagtccaacaaaacaagagacacag
gacgccctggatatctttgcaagtgagactcttagaactctgtgcctttgctacaaggaa
attgaagaaaaagaatatgaagaatggaataaaaagtttatggctgccagtatagcctcc
accaaccgggatgaagctctggataaagtgtatgaagagattgaaaaagacttaatttta
ttgggagcaacagcaattgaagacaagctacaggatggagtcccagaaaccatttcaaaa
ctcgcaaaagctgacattaagatctgggtgctcactggagataaaaaggaaactgctgaa
aatataggatttgcttgtgaacttctgactgaagacaccactatttgctatggggaggat
ataaatgctcttcttcacacaaggatggaaaaccaaaggaatagaggtggagtctatgca
aaatttgcacccccggtgcacgaacctttctttccatctggtgaaaaccgtgccttaata
atcactggttcttggttgaatgaaattcttctggagaaaaagaccaagagaagtaagatt
ctgaagctgaagttcccaaggacagaagaagaaagacggatgcggacgcaaagtaaaagg
cgtctggaagctaggaaagagcagcgacagaagaactttgtcgacctggcctgtgagtgc
agtgcagtcatctgctgccgggtcacccccaagcagaaggcaatggtggtggacctggtg
aagaggtacaagaaggccatcacgctggcaattggagacggggccaatgatgtcaacatg
atcaaaacggcccacatcggtgttggaataagtggacaagaaggcatgcaagctgtcatg
tcaagtgactactcctttgcccaattcagatacttgcagagattgctgttggtgcatggc
cggtggtcttacataaggatgtgcaagttcctacgatacttcttttacaaaaactttgca
tttactttggttcatttctggtactccttcttcaatgggtactctgcacagacggcgtac
gaagactggttcatcacgctctacaacgtgctgtactccagtctgcccgtgctcctcatg
gggctgcttgaccaggatgtgagtgacaaactgagcctccgcttccccgggttgtatgta
gtaggacaaagagacttactattcaactataagaagttcttcgtaagcttggtgcatgga
attttaacatcgatgatcctcttctttatacctcttggagcttatctacaaactgtggga
caggatggagaggcaccttcagactaccaatcttttgctgtgacaattgcttctgccctt
ataataacagtcaatttccagattggcttggatacttcttactggacttttgtgaatgct
ttttcaatttttggaagcattgcactttattttggcatcatgtttgactttcatagtgct
ggaatacatgttctctttccatctgcatttcaatttacaggcacagcgtcaaatgccctg
agacagccctacatttggctgaccatcatcctgactgttgcagtgtgcctgctgcccgtc
gttgccatacgtttcttgtctatgaccatttggccatcagaaagtgataagatccagaag
caccgcaagcggttgaaagcagaagagcagtggaagcggcggcaggtgttccgccggggg
gtgtcgtccaggcgctcggcctacgccttctcccaccagcggggctacgcggacctcatc
tcctcggggcgcagcatccgcaagaagcgctctcccctggatgcgatcatagccgacggg
accgcggagtacaggcgcacagtggagagctga

DBGET integrated database retrieval system