KEGG   Canis lupus familiaris (dog): 476437
Entry
476437            CDS       T01007                                 

Gene name
APOC1
Definition
(RefSeq) apolipoprotein C-I precursor
  KO
K22286  apolipoprotein C-I
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    476437 (APOC1)
SSDB
Motif
Pfam: ApoC-I Apo-CIII
Other DBs
NCBI-GeneID: 476437
NCBI-ProteinID: NP_001183977
Ensembl: ENSCAFG00000004615
VGNC: 37999
UniProt: P56595
Position
1
AA seq 88 aa
MRLILSLPVLVVVLSMVLEGPAPAQAAGEISSTFERIPDKLKEFGNTLEDKARAAIESIK
KSDIPAKTRNWFSEAFKKVKEHLKTAFS
NT seq 267 nt   +upstreamnt  +downstreamnt
atgaggctcattctgtcgctcccggttttggtggtggttctgtcgatggttttggaaggt
ccagcccccgcccaggcggccggagaaatctccagcacttttgagcgcatcccggataag
ctgaaggagtttggtaacaccctggaagacaaggcccgggcagccattgagagcatcaag
aagagcgacattcctgcaaagacccgaaactggttttctgaggctttcaagaaagtgaag
gagcatctcaaaactgccttctcctga

DBGET integrated database retrieval system