KEGG   Canis familiaris (dog): 476511Help
Entry
476511            CDS       T01007                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X3
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00561  Glycerolipid metabolism
cfa01100  Metabolic pathways
cfa04714  Thermogenesis
cfa04723  Retrograde endocannabinoid signaling
cfa04923  Regulation of lipolysis in adipocytes
Module
cfa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    476511 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    476511 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    476511 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    476511 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    476511 (MGLL)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     476511 (MGLL)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S33
   476511 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_3 DLH Peptidase_S9 Abhydrolase_5 PGAP1 LIDHydrolase Thioesterase DUF1057 BAAT_C Abhydrolase_2 Chlorophyllase2 TMEM117 FSH1
Motif
Other DBs
NCBI-GeneID: 476511
NCBI-ProteinID: XP_013977038
Position
20
AA seq 304 aa AA seqDB search
MPEESSPRRTPQSVPYQNLPHLVNADGQYLFCRYWKPPGTPKALIFVSHGAGEHCGRYDE
LAQMLVGLELLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDFMQKDYPGLPVFLLG
HSMGGAIAILTAAERPSHFSGMVLISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPID
SSVLSRNKTEVDLYNSDPLICRAGLKVCFGIQLLNAVTRVERALPKLTLPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRIGAAAGT
GSPP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggaaagttcccccagacggaccccacagagcgttccgtaccagaacttgcct
cacctggtcaatgccgacgggcagtacctcttctgcaggtactggaaacctccaggcaca
cccaaggccctcatctttgtgtcccatggagctggggagcactgcggccgctatgatgag
ctggctcagatgctggtggggctggagctgctggtgtttgcccacgaccatgttggccat
ggacagagcgaaggggaaaggatggtggtgtctgacttccacgttttcatcagggacgtg
ttacagcacgtggatttcatgcagaaagactacccagggcttcctgtcttccttctgggc
cactccatgggaggtgccatcgccatcctcacagccgcagagaggccgagccacttctct
ggcatggtcctgatttcacctttggttcttgccaatcctgagtctgcaacaactttcaag
gtcttggctgcgaaggttctcaaccttgtccttccaaacatgtccctgggcccaatcgac
tccagcgtgctctctcggaataagacggaggtggacctctataattcggaccccctcatc
tgccgggcaggcctgaaggtgtgctttggcatccagctgctcaacgctgtcactagagtg
gagcgggccctccccaagctgaccttgcccttcctgctgctccagggctccgccgaccgc
ctttgtgacagcaaaggggcctacttgctcatggagtccgccaagagccaggacaagaca
ctcaagatttatgaaggtgcctaccacgtcctccacaaagagcttcctgaagtgaccaac
tccgttttccgcgaaataaacatgtgggtctcccaaaggataggggcggcggcgggaacg
gggtccccaccctga

DBGET integrated database retrieval system