KEGG   Canis familiaris (dog): 476512
Entry
476512            CDS       T01007                                 

Gene name
RUVBL1
Definition
(RefSeq) ruvB-like 1
  KO
K04499  RuvB-like protein 1 (pontin 52)
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    476512 (RUVBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    476512 (RUVBL1)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     476512 (RUVBL1)
  Chromatin remodeling factors
   SRCAP complex
    476512 (RUVBL1)
   INO80 complex
    476512 (RUVBL1)
   INO80 complex (yeast)
    476512 (RUVBL1)
   SWR1 complex
    476512 (RUVBL1)
SSDB
Motif
Pfam: TIP49 TIP49_C AAA RuvB_N AAA_22 AAA_16 AAA_5 Sigma54_activat AAA_25 Mg_chelatase AAA_19 AAA_18 DnaB_C IstB_IS21 AAA_28 TsaE AAA_33 ResIII Zeta_toxin PhoH NACHT AAA_7 Parvo_NS1 AAA_11 NTPase_1 ATPase AAA_30 DUF2075 RNA_helicase
Other DBs
NCBI-GeneID: 476512
NCBI-ProteinID: XP_848712
Ensembl: ENSCAFG00000004123
VGNC: 45811
UniProt: E2RQC9
Position
20
AA seq 456 aa
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagattgaggaggtgaagagcaccacgaagacgcagcgcatcgcctcccacagccac
gtgaaggggctggggctggacgagagcggcctggccaagcaggcggcctcggggctcgtg
ggccaggagaacgcgcgagaggcatgtggtgtgatagtagaattaatcaaaagcaagaaa
atggctggaagagctgtcttgttggcaggacctcctggaactggcaagacagccctagct
ctggctatcgctcaggagctgggtagtaaggtccctttctgcccaatggtggggagtgaa
gtttactccacggagatcaagaagacagaggtgctgatggagaacttccgcagggccatt
gggttgcggataaaggagaccaaggaggtttatgaaggtgaagtcacagagctgactcca
tgtgagacagagaaccccatgggagggtatggcaaaaccattagccatgtgatcatagga
cttaaaacagccaaaggaaccaaacagttgaaactggaccccagcatttttgaaagtttg
cagaaagagcgagtagaagctggagatgtgatctacattgaagccaacagtggggctgtg
aagaggcagggcaggtgtgatacctacgccacagaattcgaccttgaagctgaagaatat
gtccccttgccaaagggcgatgtgcataagaagaaagaaatcatccaggatgtgaccttg
catgatttggacgtggccaacgcacggccccagggagggcaagacatcctgtccatgatg
ggccagttaatgaagccaaagaagacagaaatcacagacaaacttcgaggggagattaac
aaggtggtgaataagtacattgatcaaggcattgctgagctggttccaggtgtactcttt
gttgatgaggtccacatgctggacatagagtgcttcacctacctgcaccgggccctggaa
tcttccatcgcccccatcgtcatctttgcatccaaccgaggcaactgtgtcatcagaggt
actgaggacatcacttctcctcatggcattcctcttgaccttctggaccgtgtgatgatc
atccggaccatgctgtacaccccacaggaaatgaaacagatcattaaaatccgagcccag
acagaaggaatcaacatcagtgaggaggcactgaaccacctgggggagattggtaccaag
acgactctgaggtactccgtgcagctcctcacccccgccaacttgctggctaagatcaat
gggaaggacagcatcgagaaagagcacgtcgaggagatcagtgagctcttctacgatgcc
aagtcctcggccaagatcctggctgaccagcaggataagtacatgaagtga

DBGET integrated database retrieval system