KEGG   Canis lupus familiaris (dog): 476517
Entry
476517            CDS       T01007                                 

Gene name
COPG1
Definition
(RefSeq) coatomer subunit gamma-1
  KO
K17267  coatomer subunit gamma
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    476517 (COPG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    476517 (COPG1)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    476517 (COPG1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   476517 (COPG1)
SSDB
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1 MOR2-PAG1_C UNC45-central
Other DBs
NCBI-GeneID: 476517
NCBI-ProteinID: XP_533723
Ensembl: ENSCAFG00000004255
VGNC: 39507
UniProt: E2RPG9
Position
20
AA seq 874 aa
MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEH
LGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNY
RGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNE
AQEAASSDNIMVQYHALGLLYHVRKNDRLAVNKMISKFTRHGLKSPFAYCMMIRVASKQL
EEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK
AALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRL
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATTPMAEQRTESTPITAAK
QPEKVAATRQEIFQEQLAAVPEFHGLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVVSYVPARSLPYNQPGTCYTLVSLPKEDPTAV
ACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEITVADHIQKVMKLNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSSEELPVDIILASVG
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgctgaagaaattcgacaagaaagacgaggagtcgggtggaggctctaacccattccag
catcttgagaagagtgcagtactccaggaggctcgtgtatttaatgaaactcccatcaat
cctcgaaaatgtgcgcacatcctcaccaagatcctttacctcataaaccagggggagcac
ctagggaccactgaagcaactgaggccttctttgccatgaccaagctctttcagtccaat
gaccccacgctccgtcggatgtgctacttgaccatcaaggagatgtcttgcatcgctgag
gatgttattatcgtcaccagcagcctgacaaaggacatgactgggaaagaagacaactac
cggggcccagctgtgcgtgccctttgccagattactgacagcaccatgctgcaggctatc
gagcgctacatgaaacaggccatcgtggacaaggtgcccagtgtctccagttctgccctg
gtgtcttccctgcacctgctgaagtgcagctttgacgtagtcaagcgctgggtgaatgag
gcccaggaggcggcatccagcgataacatcatggtccagtaccatgctctggggctcctg
taccatgtgcgtaagaacgaccgcctggctgtcaacaagatgatcagcaagttcaccagg
cacggcctcaagtctccctttgcctactgcatgatgatccgggtggccagcaagcagctg
gaggaggaggacggcagccgtgacagcccactgtttgacttcattgagagctgtttgcgc
aacaagcatgagatggtggtgtatgaagctgcctcagccatcgtcaatctgccaggttgc
agcgccaaagagctggccccagctgtgtcagtgctccagcttttctgcagctcacctaag
gccgctctccgctatgctgctgtccgcaccctcaataaggtggccatgaagcacccttct
gcagtgacagcatgcaatctggatctggagaacctggtgacagactcaaaccgtagcatc
gctacactggccatcaccacgctcctcaagaccggcagtgagagcagcatcgaccgcctc
atgaagcagatctcgtccttcatgtcagagatctcagatgagttcaaggtggtggtggtc
caggccatcagtgccctgtgtcagaagtatcctcgcaaacacgctgtgctcatgaacttc
ctgttcaccatgctgcgggaagagggtggctttgaatacaagcgggccatcgtggattgc
atcatcagcatcattgaggagaacacagagagcaaggagacggggctgtcacacctgtgc
gagttcatcgaggactgcgagttcaccgtgctggccacccgcatcctgcatcttctaggg
caggagggacccaagaccaacaacccttccaagtatatccgcttcatctataaccgtgta
gttttggagcatgaggaggtccgggcaggtgctgtgagtgctctggccaagtttggagcc
cagaatgaagagatgttacccagtatcttggtgttgctgaagaggtgtgtgatggatgat
gacaatgaagtaagggaccgagccaccttctatctcaatgtcctggagcagaagcagaag
gccctcaatgcagggtatatcctaaatggtctgacggtttccatccctggtctggagaga
gctctgcagcagtatactctagaaccatcagaaaaaccttttgacctcaagtctgtgccc
ctggccaccacgccaatggcagagcagagaacagaaagcacccccatcacagccgccaag
cagcctgagaaagtggcagctacccggcaagagatcttccaggagcagttggcggcagtg
ccagagttccatggcctggggcccctcttcaagtcttcgcctgagcctgtggccctcact
gaatcagagacagagtatgtcatccgctgcaccaaacacaccttcactgatcacatggtg
ttccagtttgactgcacaaacacactcaacgaccagaccttggagaacgtcacagtgcag
atggagcccactgaagcctatgaggtggtctcttacgtgcctgcccgaagcctaccctac
aaccagcctgggacctgctacacattggtgtcactgcccaaggaagaccccacagctgtg
gcctgcacattcagctgcatgatgaagttcactgtcaaggactgtgaccccaccactggg
gagactgatgatgaaggctatgaagatgaatatgtgctggaagatctggaaatcactgtt
gctgatcatatccaaaaggtcatgaaactgaactttgaagcagcctgggatgaggtaggg
gatgagtttgagaaagaggaaacattcaccttgtctactatcaagacacttgaagaggct
gtgggcaatatcgtgaaattcctgggaatgcatccttgtgagaggtcagacaaagtgcca
gataacaagaacacccacacattgcttctggctggtgtgttccggggaggtcatgatatc
ttggtgcgctccagactgctgcttttggacacagtaacaatgcaggtgacagccagaagt
tcagaggagctgccagtagacatcatcttggcatctgtgggctaa

DBGET integrated database retrieval system