KEGG   Canis lupus familiaris (dog): 476617
Entry
476617            CDS       T01007                                 

Symbol
SLC38A3
Name
(RefSeq) sodium-coupled neutral amino acid transporter 3
  KO
K13576  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 3
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04724  Glutamatergic synapse
cfa04727  GABAergic synapse
cfa04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    476617 (SLC38A3)
  09156 Nervous system
   04724 Glutamatergic synapse
    476617 (SLC38A3)
   04727 GABAergic synapse
    476617 (SLC38A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfa02000]
    476617 (SLC38A3)
Transporters [BR:cfa02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   476617 (SLC38A3)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 476617
NCBI-ProteinID: XP_005632572
Ensembl: ENSCAFG00000010754
VGNC: 46394
UniProt: E2R7Z7
Position
20:complement(39029425..39043601)
AA seq 504 aa
MEAPLQTEMVELVPNGKHSEGLLPAPTPMAGHQRVEGPRRSCVEGEGFLQKSPSKEQHFT
DFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKS
SGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEE
QTSDWYMNGNYLVILVSITVILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFHVPC
PLPLNFANITGNVSLIEVTKEEAQLQVETEATALCTPSYFTLNSQTAYTIPIMAFAFVCH
PEVLPIYTELKDPSKKKMQHISNLSIAVMYVMYFLAALFGYLTFYDGVESELLHTYSKVD
PFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFKNQEFNWLRHTLIAIGLLTCINL
LVIFAPNILGIFGVIGATSAPCLIFIFPAIFYFRIMPTEKEPAKSTPKILALCFAVLGLL
LMTMSLSFIIIDWVSGTDRHGGSH
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaggcacccctgcagacggaaatggtggagctggtgcccaacggcaaacactcggag
gggctgctcccagcacccaccccgatggcaggccaccagagggtcgagggccccagacgg
agctgtgttgagggcgagggcttcctacagaaaagccccagcaaggagcagcacttcact
gactttgaggggaagacctcatttgggatgtcggtgttcaatctcagcaacgccatcatg
ggcagcggcatcctggggctcgcctacgccatggccaacacgggcatcatccttttcctg
ttcctgctgacagccgtcgccctgctctccagctactccatccacctgctactcaagtcc
tcagggatcgtgggcatccgtgcctatgagcagctgggctaccgtgcctttgggacccca
ggaaagctggccgcggccctggccatcacgctgcagaatattggagccatgtccagctac
ctgtacatcatcaagtctgagctgcctcttgtcatacagaccttcctgaacctggaggag
caaacctcggactggtacatgaacgggaactacctggtgatcctagtttctatcactgtc
attctgcctctggcactgatgcggcagcttggctacctgggttactccagcggcttctct
ctcagttgcatggtgttcttcctaatcgcagtcatctacaaaaagttccacgtgccctgc
ccactgcccctcaactttgccaacatcacaggcaatgtcagcctcatagaggtcaccaag
gaggaggcgcagctgcaggttgagacagaggccacagccctctgcaccccaagctacttc
acactcaactcacagacggcatataccattcccatcatggccttcgcctttgtctgccat
ccggaggtgctgcccatctatacagagctcaaggatccctccaagaagaagatgcagcat
atctccaacttgtccatcgctgttatgtacgtcatgtacttcctggctgccctcttcggc
tacctcaccttctacgatggggtggagtcggagctactgcacacctacagcaaggtggac
ccatttgatgtgctgatcctctgtgtgcgtgtggccgtgctgacagcagtcacgctcacc
gtgccaatcgttctgtttccggtgcgccgagccatccaacagatgctgtttaagaaccag
gagttcaattggctgcggcacacgctcattgccattggcctgctcacttgtatcaacctg
ctggttatcttcgctcccaatatcctgggcatcttcggggtcatcggtgccacatctgcc
ccatgcctcatcttcatcttccctgccatcttctatttccgcatcatgcccaccgagaag
gaacctgcaaagtctacccccaaaatcttggccctttgtttcgctgtgcttggcctcttg
ctgatgaccatgagtttgagcttcattatcattgactgggtgtcagggactgaccggcat
ggaggaagccactag

DBGET integrated database retrieval system