KEGG   Canis familiaris (dog): 477002Help
Entry
477002            CDS       T01007                                 

Gene name
ACSS1
Definition
(RefSeq) acetyl-coenzyme A synthetase 2-like, mitochondrial
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00620  Pyruvate metabolism
cfa00640  Propanoate metabolism
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    477002 (ACSS1)
   00620 Pyruvate metabolism
    477002 (ACSS1)
   00640 Propanoate metabolism
    477002 (ACSS1)
Enzymes [BR:cfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     477002 (ACSS1)
Lipid biosynthesis proteins [BR:cfa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   477002 (ACSS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 477002
NCBI-ProteinID: XP_534200
VGNC: 52863
Position
23
AA seq 680 aa AA seqDB search
MAARGLGRGLGLLVRGLCGRPGRPGRAGRAGRAARGLSASPAAAQPGSYEARSALAAREP
AAFWGPLARDALVWDAPYHTVWDCDFGSGRIGWFLGGRLNVSVNCLDQHVQKSPESVALI
WERDEPGTEVRITYRELLETTCRLANTLKRHGIRRGDRVAIYMPVSPLAVAAMLACARIG
AVHTVVFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTVQHVL
VAHRTDNKVHMGHLDIPLEQEMAKEDPVCAPESMGSEDMLFLLYTSGSTGTPKGLVHTQA
GYLLYAALTHKLVFDYRPGDVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPDA
GRYWEMVQRLKINQFYGAPTAVRLLLKYGDSWVKKYDRSSLRTLGSVGEPINFEAWEWLH
KVVGDGRCTLVDTWWQTETGGICIAPRPSEEGAEILPGMAMRPFFGIVPVLMDEKGKVVE
GGNISGALCLSQAWPGMARTIYGDHQRFMEAYFKPYPGHYFTGDGAYRTEDGYYQITGRM
DDVINISGHRLGTAEIEDAMANHPAVPETAVIGYPHDIKGEGAFAFIVLKDNTGDTDAVV
KELKSAVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITGRTQDLGDITTLEDPS
VITEILSAYQKYKDKQASSQ
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacgcggcctggggcgcggcctggggctgctagtgcgcggcctgtgcgggcgg
ccggggcggccggggcgggcggggcgggcggggcgggcggcgcgcgggctcagcgcctcc
cccgcggccgcgcagccgggctcgtacgaggcacggagcgccctggccgcgcgggagccc
gccgccttctgggggccgctggcgcgcgacgcgctggtgtgggacgccccgtaccacacc
gtctgggactgtgacttcggcagcggcaggatcggctggttcctgggaggccggctgaac
gtgtccgtcaactgcttggatcagcatgttcagaagtccccggagagtgttgctttgatc
tgggagcgggatgagcctggaactgaagtgaggatcacatacagggaactgctggagacc
acatgccgcctggccaacacgctgaagagacatggaatccgtcgaggggaccgtgtggcc
atctacatgcctgtttccccactggcggtggctgcaatgctggcctgtgccaggattgga
gccgtccacaccgttgtctttgctggcttcagtgcagagtccttggctgggaggatcaat
gatgccaagtgcaaggtggtcatcaccttcaaccaaggactccggggagggcgcgtggtg
gagctgaagaagatcgtggatgaagccgtgaagcactgcccgaccgtccagcatgtcctg
gtggctcacaggacggacaacaaggtccacatggggcatctggacatccctctcgagcag
gagatggccaaggaggatcctgtgtgtgccccagagagcatgggcagtgaggacatgctt
ttcttgctgtacacttcagggagcactgggacgcccaagggactcgtccacacccaggcg
ggctacctgctgtatgctgccctaacacacaagcttgtgtttgactaccggccaggtgac
gtctttggctgtgtggctgacattggctggatcacaggacacagctatgtggtgtacgga
cctctgtgcaatggagcaaccagcgtcctttttgagagcaccccggtttaccccgatgct
ggtcgatactgggagatggtgcagaggttaaagatcaatcagttctatggggccccgacg
gctgtccggctgttgttgaaatacggcgactcctgggtgaagaagtatgaccgctcttcc
ctgaggaccctggggtcagtgggagaaccaatcaacttcgaggcttgggagtggctccac
aaagtggtgggggacggcagatgcacgctggtggacacctggtggcagacagaaacgggt
ggcatctgcattgcaccacggccctcagaagaaggggcagagatcctccctggcatggcg
atgaggcctttttttggcattgtcccagtgctcatggacgagaagggaaaggtcgtggag
ggtggtaacatctccggggctctgtgcctgtcccaggcctggccaggcatggccaggacc
atctatggagaccaccagagattcatggaggcctacttcaagccttacccaggccactac
ttcactggtgatggggcataccggacagaggatggctactaccagatcacagggcggatg
gatgacgtcatcaacatcagtggccacaggctggggacggcagagatcgaggatgcaatg
gctaaccaccctgctgtgccagagaccgctgtcattggctacccgcatgacatcaaagga
gagggtgcatttgccttcatcgtgttgaaggacaacacaggtgacacagatgcagtggtg
aaggagctcaagtcagcagtggccaccaagattgccaagtatgctgtgcccgatcagatt
ctggtagtgaagcgtcttccaaagactcggtctggaaaagtcatgcggaggctcctgagg
aagataatcacaggcagaactcaagatctgggggacatcaccaccctggaggaccccagt
gtcatcacagaaatcctgagtgcctaccagaaatacaaagacaagcaagcttcctctcag
tga

DBGET integrated database retrieval system