KEGG   Canis familiaris (dog): 477004Help
Entry
477004            CDS       T01007                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X4
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     477004 (ABHD12)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   477004 (ABHD12)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   477004 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 477004
NCBI-ProteinID: XP_005634224
Ensembl: ENSCAFG00000004389
VGNC: 37458
Position
23
AA seq 327 aa AA seqDB search
MKKILLCVLGLYVAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQ
PEEDVTIGVWHTVPAVWWKDAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYK
VLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGV
ATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIK
FANDENVKHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSRSFRDFKVQFIPFHSDLGYR
HKYIYRSPELPRILREFLGKSEPGRQH
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatacttctctgtgttctggggttgtatgttgccattccatttctcatcaaa
ctgtgtcctgggatacaggccaaactgattttcttgaattttgtgagggttccctatttc
attgacttgaaaaaaccacaggatcaaggtttgaatcacacgtgtaattactacctccag
ccagaggaagatgtgaccattggagtctggcacactgtccctgctgtctggtggaaggac
gcccaaggaaaggaccagatgtggtacgaggatgccttggcttccagccaccctatcatc
ctgtacctccatgggaatgcaggcaccagaggaggcgaccatcgggtggagctttataag
gtgctgagttcccttggttaccacgtggtcacctttgactacagaggttggggtgactca
gtaggaaccccatcagagcgaggcatgacctatgatgcactccatgtttttgactggatc
aaagcccggagtggagacaaccctgtgtatatttggggtcattccctaggcactggggtg
gcgacaaatctggtgcggcgcctctgtgagcgagagacacctccagatgcccttatattg
gaatctccattcactaatatccgtgaggaagctaagagtcatccattctcagtgatatat
cgatacttccctgggtttgactggttcttcctcgaccccattacaagcagcggaattaaa
tttgcaaatgatgaaaatgtgaagcacatctcctgctccctgcttatcctgcacgcggag
gatgacccggtcgtgcccttccagcttggcagaaagctctacaacatcgctgctccatct
cgaagcttccgagacttcaaagttcagtttatcccctttcactcagaccttggctacagg
cacaagtacatctacaggagccctgagcttccacggatactgagggagttcctggggaag
tcagaacccgggcgccagcactga

DBGET integrated database retrieval system