KEGG   Canis familiaris (dog): 477032Help
Entry
477032            CDS       T01007                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04015  Rap1 signaling pathway
cfa04310  Wnt signaling pathway
cfa04390  Hippo signaling pathway
cfa04510  Focal adhesion
cfa04520  Adherens junction
cfa04550  Signaling pathways regulating pluripotency of stem cells
cfa04670  Leukocyte transendothelial migration
cfa04916  Melanogenesis
cfa04919  Thyroid hormone signaling pathway
cfa04934  Cushing syndrome
cfa05100  Bacterial invasion of epithelial cells
cfa05132  Salmonella infection
cfa05160  Hepatitis C
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05200  Pathways in cancer
cfa05205  Proteoglycans in cancer
cfa05210  Colorectal cancer
cfa05213  Endometrial cancer
cfa05215  Prostate cancer
cfa05216  Thyroid cancer
cfa05217  Basal cell carcinoma
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
cfa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cfa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    477032 (CTNNB1)
   04310 Wnt signaling pathway
    477032 (CTNNB1)
   04390 Hippo signaling pathway
    477032 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    477032 (CTNNB1)
   04520 Adherens junction
    477032 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    477032 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    477032 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    477032 (CTNNB1)
   04916 Melanogenesis
    477032 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    477032 (CTNNB1)
   05205 Proteoglycans in cancer
    477032 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    477032 (CTNNB1)
   05225 Hepatocellular carcinoma
    477032 (CTNNB1)
   05226 Gastric cancer
    477032 (CTNNB1)
   05216 Thyroid cancer
    477032 (CTNNB1)
   05217 Basal cell carcinoma
    477032 (CTNNB1)
   05215 Prostate cancer
    477032 (CTNNB1)
   05213 Endometrial cancer
    477032 (CTNNB1)
   05224 Breast cancer
    477032 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    477032 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    477032 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    477032 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    477032 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    477032 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    477032 (CTNNB1)
   05163 Human cytomegalovirus infection
    477032 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    477032 (CTNNB1)
   05165 Human papillomavirus infection
    477032 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 477032
NCBI-ProteinID: NP_001131124
Ensembl: ENSCAFG00000005204
VGNC: 39700
UniProt: B6V8E6
Position
23
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggattctggaatccattctggtgccact
accacagctccttctctcagtggtaaaggcaatcccgaggaagaagatgtggataccacc
caagtcctgtatgagtgggaacagggcttttctcaatccttcactcaagaacaagtagct
gatattgatggtcagtatgcaatgactcgagctcagagggtgcgggctgctatgttccct
gagacattagatgaaggcatgcagatcccatctacacagttcgatgctgctcatcctact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcacaat
ctttctcatcatcgtgagggcttgctggccatctttaagtctgggggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattattttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtggactgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttacgggaatcaagaaagcaagctgatcattctggctagtggtgga
cctcaagctttagtaaatataatgaggacctacacttacgagaaactcctgtggaccaca
agcagagtattgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagca
ggtggaatgcaggctttagggcttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactctaaggaatctatcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctgggctcagatgatataaatgtggtcacgtgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgtgctggtgacagggaggacatt
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatg
gcccagaatgctgttcgccttcactatggactgccagttgtggttaaactcctgcaccca
ccatcccattggcctctaataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctctgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcccatcaggatacccagcgccgtacatctatgggtggaacacagcagcagttt
gtggagggggtccgtatggaagaaattgttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaatcgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagccattgaagcggagggagccacagctcctctg
acagagttacttcactctaggaacgaaggtgtagcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcggttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system