KEGG   Canis familiaris (dog): 477045Help
Entry
477045            CDS       T01007                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05200  Pathways in cancer
cfa05222  Small cell lung cancer
cfa05223  Non-small cell lung cancer
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    477045 (RARB)
   05226 Gastric cancer
    477045 (RARB)
   05222 Small cell lung cancer
    477045 (RARB)
   05223 Non-small cell lung cancer
    477045 (RARB)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    477045 (RARB)
Nuclear receptors [BR:cfa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   477045 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 477045
NCBI-ProteinID: XP_003433175
Ensembl: ENSCAFG00000005727
VGNC: 45352
Position
23
AA seq 455 aa AA seqDB search
MTTSSHACPVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNPAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagtagccacgcatgtcccgtcccagcagtgaatggacacatgactcactat
ccagctgcaccctacccattgctctttccaccagtcattggaggactttccctgcctccc
ctccatggccttcacggccaccctcctccaagtggatgcagtaccccatcacctgcaacg
attgaaacacagagcaccagctccgaggaactggtcccaagccctccgtctccacttcct
ccccctcgtgtgtacaaaccctgcttcgtctgccaggacaaatcatcggggtaccactat
ggggtcagcgcctgtgagggctgtaaggggtttttccgcagaagtattcagaagaacatg
atttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcgatgc
cagtactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatctgtcaggaat
gataggaacaagaagaagaaggagccttcgaagcaggaatgcacagaaagctatgaaatg
acagctgagctggacgatctcacggagaagatccgcaaagcccaccaggaaaccttcccc
tcactctgccagctgggcaaatacaccacgaattccagtgctgaccatcgagtccgactg
gacctgggcctctgggacaaattcagtgaactggccaccaagtgcattattaagattgtg
gagtttgctaaacgtctgccaggcttcaccggcttgaccatcgcggaccaaatcaccctg
ctgaaggccgcctgcctggacattctgattcttagaatttgcaccaggtataccccagaa
caagacaccatgactttttcagatggccttaccctaaatcgaactcagatgcacaatgct
ggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctgcctttggaa
atggatgacacagaaacaggccttctcagtgccatctgcttaatctgtggagaccgccag
gaccttgaggaaccaacaaaagtagataagctacaggaaccactgctggaagcactaaaa
atttatatcagaaagagacgacccagcaagcctcacatgtttccaaagatcttaatgaaa
atcacagatctccgcagcatcagtgctaaaggtgcagaacgtgtaattaccttgaaaatg
gaaattcctggatcaatgccacctctcattcaggaaatgctggagaattctgaaggacat
gaacccttgaccccaagttcaagtgggaacccagcggagcacagtcccagcatctcacct
agctcagtggaaaacagcggtgtcagtcaatcaccactggtgcaataa

DBGET integrated database retrieval system