KEGG   Canis familiaris (dog): 477088Help
Entry
477088            CDS       T01007                                 

Gene name
COPB2
Definition
(RefSeq) coatomer subunit beta' isoform X1
  KO
K17302  coatomer subunit beta'
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    477088 (COPB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    477088 (COPB2)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    477088 (COPB2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   477088 (COPB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coatomer_WDAD WD40 MetallophosC
Motif
Other DBs
NCBI-GeneID: 477088
NCBI-ProteinID: XP_005634562
Ensembl: ENSCAFG00000007602
VGNC: 39505
UniProt: E2R667
Position
23
AA seq 906 aa AA seqDB search
MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPV
RAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDD
MLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFT
LEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPE
LPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASLRGSNNVALGYDEGSIIVKLG
REEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQH
NPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAIRESNSVVKIFKNFKE
KKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIA
TEESFFILKYLSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSV
NRLNYYVGGEIVTIAHLDRTMYLLGYIPKDNRLYLGDKELNIVSYSLLVSVLEYQTAVMR
RDFSMADKVLPTIPKEQRTRVAHFLEKQGFKQQALTVSTDPEHRFELALQLGELKIAYQL
AVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLLLLATASGNASMVNKLAEGAE
RDGKNNVAFMSYFLQGKLDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKV
NQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEAK
GFQPSRSAAQQELDGKPASPTPVIVTSHTANKEEKSLVELEVDLDNLELEDIDTTDINLD
EDILDD
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcgacttgatataaagagaaagttaactgctcgatcggatcgagttaagagt
gtggatttgcatcctacagagccatggatgttggcaagtctttacaatggcagtgtgtgc
gtttggaatcatgaaacacagacattggtgaaaacatttgaagtgtgtgatcttcctgtt
cgagctgcaaagtttgttgcaagaaagaattgggttgtgacaggagcggatgacatgcag
attagagtgttcaattacaatactttggagagagttcatatgtttgaagcacactcagac
tatattcgttgtattgctgttcatccaacccagcctttcattctgactagcagcgatgac
atgcttattaagctctgggactgggataaaaaatggtcctgctcacaagtgtttgaagga
cacactcattatgtcatgcagattgtgatcaatcccaaagataacaatcagtttgccagt
gcatctttggacaggaccatcaaggtttggcaattgggttcttcctcaccaaacttcact
ctggaaggacatgagaaaggcgtgaattgcatcgattactacagtggtggtgataaacca
tacctcatttcaggtgcagatgaccgtcttgttaaaatatgggactatcagaataagaca
tgtgtacagacactggagggacatgctcaaaatgtgtcttgtgccagttttcatcctgag
ttgccaatcatcatcacaggttcagaagacggaaccgtgcgtatttggcattccagcacg
taccgccttgagagcacattgaattatggaatggagagggtgtggtgtgtggccagtctg
agagggtccaacaatgttgctttgggctatgatgaagggagcatcattgtgaagcttggt
cgggaggaacctgccatgtccatggatgccaatggaaagataatttgggccaagcattca
gaagtccagcaggccaacctaaaagcaatgggagatgctgaaattaaagatggagaaaga
ctgccattagcagtcaaggacatgggcagttgtgaaatatatccccagactattcagcac
aatcctaatggacggtttgttgtggtgtgtggcgatggtgagtatattatctacacagca
atggcgttgagaaacaagagctttggatctgcccaggagtttgcatgggcccatgattct
tcagaatatgcaataagagagagcaacagtgttgtaaagatatttaagaactttaaggaa
aaaaaatcatttaaaccagattttggagctgaaagtatctatggaggcttcttattggga
gtcagatctgtaaatggcttagctttctatgactgggacaatacagaactcatacgcaga
attgaaattcagcccaaacacattttctggtctgactctggagagctggtctgtattgcc
accgaggagtcattttttatcttgaagtatctgtctgaaaaagtcttggctgcacaggaa
acacatgagggagttactgaagatggcattgaagacgcctttgaggttcttggtgagatt
caggaaattgtgaaaacagggctgtgggtaggcgattgcttcatttacacaagttctgtg
aacagattaaattattatgttggaggagaaatagtcaccattgcccacttggacaggaca
atgtatctcctgggctatattcctaaagacaacaggctttatctgggtgataaagaactg
aacattgttagctattctctgctggtttccgtgctggaataccagacagctgtcatgaga
agggactttagcatggctgataaggttcttcctaccattccaaaagaacagaggaccaga
gttgcacactttctggaaaagcaaggcttcaagcagcaagctcttacagtatccacagat
ccggagcatcgctttgaacttgctctacagcttggagaactgaaaatcgcataccaatta
gcagtagaagcagagtcagaacaaaagtggaaacaacttgccgaacttgccattagtaaa
tgtcagtttggccttgcccaggagtgcctgcaccatgcacaggattatggaggcctgttg
ctcttggccactgcctctggaaatgctagtatggtgaacaaactagcagagggtgcagag
agagatggcaagaataacgtggcattcatgagctactttttacagggcaagctagatgcc
tgcctggaactcttgattagaacaggtcgattgcctgaagccgccttcctagcccggact
tacttacccagtcaggtttcaagggtggtgaaactctggagagaaaatctttcaaaagtc
aatcagaaagcagcagaatcccttgcagatccaacagaatatgaaaacctttttcctgga
ttaaaagaagcctttgttgtagaagaatgggtgaaggaaacacatgctgatctgtggcca
gccaagcagtacccacttgtcacgccaaatgaagaaagaaatgttatggaagaggcaaaa
ggctttcagccctcaagatctgcagctcaacaggaacttgatgggaaacctgcttctcct
actccagtaattgtcacctcccacacagccaacaaagaagaaaagagtttagtcgaactg
gaagtagatctggataatttagaattagaagatattgacacaacagacatcaacctggat
gaagatattttggatgattga

DBGET integrated database retrieval system