KEGG   Canis lupus familiaris (dog): 477265
Entry
477265            CDS       T01007                                 

Gene name
ATP9A
Definition
(RefSeq) probable phospholipid-transporting ATPase IIA
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    477265 (ATP9A)
Enzymes [BR:cfa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     477265 (ATP9A)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase E1-E2_ATPase Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 477265
NCBI-ProteinID: XP_534457
Ensembl: ENSCAFG00000011659
UniProt: F1PGM6
Position
24
AA seq 1029 aa
MTLGKCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPGVLFNQFK
YFFNLYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTVIREAVEEIRCYVRDREVNCQV
YSRLTARGTVKVKSSNIQVGDLIIVEKNQRVPADMIFLRTSEKNGSCFLRTDQLDGETDW
KLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFVGTFTREDSDPPISESLSIENTL
WAGTVIASGTVVGVVLYSGRELRSVMNTSNPRSKIGLFDLEVNCLTKILFGALVVVSLVM
VALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTI
PEQLGRISYLLTDKTGTLTQNEMVFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPA
QKGPTLTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQYEDSCRVYQAS
SPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQILNFTILQIFPFTYESKRMGIIVRDE
STGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLAEEQYQDFEARY
VQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTG
DKLETATCTAKNAHLVTRNQDIHVFRLVTNRSEAHLELNAFRRKHDCALVISGDSLEVCL
KYYEYEFMELACQCPAVVCCRCTPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQESDC
GVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQA
VFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRP
LSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHW
LMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFS
PPSYSKLTS
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgaccttgggcaagtgctgtgagtggctgagatgctgtggcggaggggaacccaggccc
cgcactgtgtggttggggcatcccgagaagagggaccagaggtaccctcgaaatgtcatc
aacaatcagaagtacaacttcttcacctttcttcctggggtgctgttcaaccagttcaaa
tactttttcaacctctatttcttactccttgcctgctctcagtttgtccctgagatgaga
ctcggtgcgctctacacctactgggtccccctgggcttcgtgctggctgtcaccgtcatc
cgggaggcagtggaggagatccgatgctatgtgcgcgacagggaggtcaactgtcaggtc
tacagccggctcacggcgagagggacggtgaaggtgaagagctccaacatccaggttgga
gatcttatcatcgttgagaagaaccagcgggtccctgctgacatgatcttcctgaggaca
tcagaaaaaaacgggtcttgtttcctgcggacggatcagctggacggggagacagattgg
aagctgcggctccccgtggcctgcacgcagaggctccccactgctgccgatctccttcag
attcgatcatatgtctatgcagaagagccaaatatcgacattcacaactttgtgggaact
tttaccagagaggacagcgaccctccgatcagcgagagtttgagcattgagaacacgctc
tgggccggcactgtcatcgcgtcgggtactgttgtgggtgttgttctttacagcggcaga
gaactccggagtgtcatgaatacctcaaaccctcgaagtaagattggcctgtttgacctg
gaggtgaactgcctcacaaagatcctctttggtgctttggtggtggtgtcactggtcatg
gttgcccttcagcactttgctggtcgttggtacctacagatcatccgcttcctcctcttg
ttttccaacatcattcccatcagcctgcgtgtgaacctcgacatgggcaagattgtgtac
agctgggtgattcggagggactcgaaaatccccgggactgtggttcgttctagcaccatc
cctgagcagctggggaggatttcttacttactcacggacaagacaggaactcttacccag
aatgagatggttttcaaacggctccatctaggcaccgtggcttatggcctcgactcaatg
gatgaagttcagagccacatattcagtatttatacccagcaatcccaggacccacctgct
cagaagggccccacgctcaccaccaaagtccggcggaccatgagcagccgtgtgcacgag
gctgtgaaggccatcgcactctgccacaacgtgactcccgtgtacgagtccaatggcgtg
accgaccaggccgaggccgagaagcagtacgaggactcctgccgcgtgtaccaggcgtct
agcccagatgaggtggccctggtacagtggaccgaaagtgtgggcttgaccctggtgggc
cgagaccagtcttccatgcagctgaggacccctggcgaccagatcctgaacttcaccatc
ctgcagatcttccccttcacctacgaaagcaagcgcatgggcatcatcgtgagggatgaa
tcaacgggagagatcacgttttacatgaagggagcggatgttgtcatggctggcatcgtg
cagtacaatgactggctggaggaagagtgtggaaacatggcccgagaaggactgcgggtg
cttgtggtggccaagaagtctctagcggaggagcagtatcaagactttgaggcccgctat
gtccaggccaagctgagcgtgcacgaccgctctctcaaagtggccaccgtgatcgagagc
ctggagatggagatggagttgctgtgcctgacgggggtggaggaccagctgcaggcagac
gtgaggcccacactcgagaccctgaggaatgccggcatcaaggtttggatgctgacaggg
gacaagctggagacagctacatgcactgcgaagaatgcacatctggtgaccagaaaccaa
gacatccacgtttttcggctggtgaccaaccgcagcgaggcccacctcgagctgaacgct
ttccgcaggaagcacgactgtgccctggtcatctcgggagactccctggaggtttgcctc
aagtactacgagtacgagttcatggagctggcctgccagtgcccggccgtggtctgctgc
cgctgcacccccacccagaaggcccagatcgtgcgcctgctgcaggaacgcaccgggaag
ctcacctgtgccgtaggtgatggaggcaatgacgtcagtatgattcaggaatccgactgc
ggcgtaggtgtcgaggggaaggaaggaaaacaggcttccctggctgcagacttctccatc
acccagttcaagcacctcggccggctactcatggtgcatggccggaacagctacaagcgg
tcagccgccctcagccagttcgtgatccacaggagcctctgtattagcaccatgcaggct
gtcttttcttccgtgttttactttgcctccgttcctctctatcaaggattcctcatcatt
gggtactccaccatttacaccatgtttcctgtgttttccctggtcctggacaaagatgtc
aagtcggaagttgccatgctgtatcctgagctctacaaagatctcctcaagggaagacca
ttgtcctacaagaccttcctaatatgggttctgattagcatctatcaagggagcaccatc
atgtatggggccttgctgctgtttgagtccgagttcgtgcacatcgtggcgatctccttc
acgtcgctgatcctcacggagctgctgatggtggccctgaccatccagacatggcactgg
ctcatgacggtggccgagttgctcagtctggcctgctacatcgcctccctggtgttccta
catgaattcatcgatgtgtacttcatcgccactttgtcgttcttgtggaaggtctccgtc
atcactctggtcagctgtctgcccctgtacgttctcaagtatctgcggagacggttctcc
ccgcccagctactcaaagctcacgtcgtag

DBGET integrated database retrieval system