KEGG   Canis familiaris (dog): 477412Help
Entry
477412            CDS       T01007                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04136  Autophagy - other
cfa04140  Autophagy - animal
cfa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    477412 (ATG16L1)
   04136 Autophagy - other
    477412 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    477412 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    477412 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    477412 (ATG16L1)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    477412 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    477412 (ATG16L1)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    477412 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 Fez1 KASH_CCD ZapB TolB_like HALZ V_ATPase_I Phage_GPO
Motif
Other DBs
NCBI-GeneID: 477412
NCBI-ProteinID: XP_005635923
Ensembl: ENSCAFG00000011752
VGNC: 38219
Position
25
AA seq 623 aa AA seqDB search
MSSGLRAADFPRWKRHISEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAHKLQAEK
HDIPNRHEISPGHDGAWNDGQLQEMAQLRIRHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQMNEAKIAECLQTISDLETECQELRSKLQDLERANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHAEETSPVRAISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSDAAR
RRSVSSFPVPQDNVDTHPGSSKEVRVPTTAMCIFDAHDGEVNAVQFSPGSRLLATGGMDR
RVKLWEVFGDKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTL
TGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMS
GHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKIIDLRINAVRQ
TFSAPGFKCGSDWTRVVFSPDGGYVAAGSAEGSLYIWSVLSGKVEKVLSKQHGSSINAVA
WSPSGSHVVSVDKGSKAVLWSEY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgccgacttcccccgctggaagcgccacatttcggaggag
ctgaggcggcgggaccggctgcagaggcaggcgttcgaagagatcatcctgcagtataac
aagttgctagaaaagtcagatcttcattcagtgctggcccataagctccaagctgaaaag
catgacatccccaacaggcatgagataagtcctggacacgatggcgcatggaacgacggt
cagctacaggaaatggcccagctgaggatcagacaccaggaagaactgactgaactacac
aagaagcgtggggagttagctcaattggtgattgacctgaataaccaaatgcagcagaaa
gacagggagatgcagatgaatgaagcaaaaattgcagaatgcttgcagacgatctctgac
ctggagacggagtgccaagaactacgcagtaagcttcaagacctcgaaagggccaaccag
accctgaaggacgaatatgatgctctgcagatcacgtttactgctttggaggagaaattg
aggaaaactactgaagagaatcaggagctggtcacccggtggatggctgagaaagcccag
gaagccaatcgcttaaatgcagagaatgaaaaggattcaaggagacggcaagcccggctg
cagaaagagcttgcagaagcagcaaaggaacctctacccgttgaacaggatgatgacatt
gaagtcattgtggacgaaacctctgatcacgctgaggagacgtctcctgtgcgagccatc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtccgagtctccccttttgggacatcactcttctgatgctgccagg
aggcgctctgtctcttcctttccagttccccaggataatgtggatactcatcctggttct
agtaaagaagtgagagtgcctacaacagcgatgtgtatctttgatgctcatgatggggaa
gtcaacgctgtgcagttcagccccggctcccggctgctggccacaggaggcatggatcgg
agagttaagctttgggaagtgtttggagataaatgtgagttcaagggttccctgtctggc
agtaatgcgggaattacgagcatcgaatttgacagtgctggatcttacctcttagcagct
tcaaatgattttgcaagtcgaatctggactgtggatgattatcggttacggcacacgctc
acaggacacagcggcaaagtgctgtctgccaaattcctgctggacaatgcccgtattgtt
tctggaagtcatgaccggaccctcaagctctgggatctacgcagcaaagtctgcataaag
acggtgtttgcaggatccagctgcaacgatatcgtctgcacagagcagtgtgtcatgagt
ggccattttgacaagaaaattcgtttctgggacatccgatcggagagcatcgtccgggag
atggagctgctggggaagattacggccctggacttaaacccggaaagaacagaactcctc
agctgctcccgtgatgacttgctaaagatcatcgatctgcgaataaatgctgtcagacag
acgtttagcgcacctgggttcaagtgcggctccgattggaccagagttgtgtttagccct
gatggtggttatgtggcagcgggctcggctgagggctctctctacatctggagcgtgctc
tcagggaaagtggagaaagtcctttccaagcagcatggctcgtccatcaatgctgtggcg
tggtccccctccggctcgcacgttgtcagtgtggacaaaggaagcaaagctgtgctctgg
tcggaatattga

DBGET integrated database retrieval system