KEGG   Canis familiaris (dog): 477612
Entry
477612            CDS       T01007                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    477612 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    477612 (ASIC1)
Ion channels [BR:cfa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   477612 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 477612
NCBI-ProteinID: XP_005636918
Ensembl: ENSCAFG00000008318
VGNC: 38177
UniProt: E2R4M9
Position
27
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPQQRRQRDNSESEEEEEEKEQEAVRKEAREEDSP
MDLVAFANSCTLHGASHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLDCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGRFRGASILT
VLELFAYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattctcctctggagaggaggccccagggccc
ttgggagatgtttggggtccccaacagcggcggcagcgggacaactcagaatcagaagag
gaggaagaagagaaggaacaggaggcagtgaggaaggaggctagagaggaggattcgccc
atggatctggtggcctttgccaacagctgtaccctgcatggcgccagccacatcttcgtg
gagggaggtccggggccgaggcaggccctgtgggcagtggcctttgtcttggcattgggc
gccttcctgtgccaggtgggggaccgcgtcgcctattacctcagctacccgcacgtgact
ctgctagatgaggtggccaccacggagctggccttcccggcagtcaccctctgcaacacg
aatgccgtgcgcctgtcccagctcagctaccccgacttgctctacctggcccccatgctg
gggctggatgaaagtgatgaccctggggtgcctcttgccccaccggggccggaggccttc
tctggggagccctttaacctgcatcgcttctacaatcgctcctgccaccggctggaggac
atgctgctcgattgctcctactgcggggggccctgtggccctcacaacttctcggtggtc
ttcacacgatatggaaagtgctatacattcaactcgggccgagatgggcgtccacggctg
aagaccatgaagggtgggactggcaatgggctggagataatgctggacatccagcaggat
gagtacctgcctgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtg
cagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggcccca
gggttccagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagcattactgcc
tgccgcatcgactgtgagacacgctacctggtggagaactgtaactgccgcatggtgcat
atgccaggggatgccccatactgcactccagaacagtacaaggagtgtgcggatcctgct
ctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaacctg
acccgctatggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaagtac
ctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgca
gggctcctgggtgacattgggggccagatggggcggtttagaggggccagcatcctcaca
gtactggagctcttcgcatacgcctatgaggttattaaacacaagctgtgccgaagagga
aagtgccagaaggaggccaaaaggagcagcgcggacaagggtgtggcccttagcctggat
gacgtcaaaagacataacccgtgtgagagcctccggggccaccctgccgggatgacgtat
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system