KEGG   Canis familiaris (dog): 477711Help
Entry
477711            CDS       T01007                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa00051  Fructose and mannose metabolism
cfa00562  Inositol phosphate metabolism
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa01230  Biosynthesis of amino acids
Module
cfa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfa_M00002  Glycolysis, core module involving three-carbon compounds
cfa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    477711 (TPI1)
   00051 Fructose and mannose metabolism
    477711 (TPI1)
   00562 Inositol phosphate metabolism
    477711 (TPI1)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     477711 (TPI1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   477711 (TPI1)
  Exosomal proteins of bladder cancer cells
   477711 (TPI1)
  Exosomal proteins of melanoma cells
   477711 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 477711
NCBI-ProteinID: NP_001183983
Ensembl: ENSCAFG00000014553
VGNC: 47740
UniProt: P54714
Position
27
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDAKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgtcggggggaactggaagatgaacgggcgcaagaag
aacctgggggagctcatcaccaccctgaacgcggccaaggtgccggccgacaccgaagtg
gtttgtgcacctcccactgcctacatcgacttcgctcggcagaagctagatgccaagatt
gctgtggctgcacagaactgctacaaagtgactaacggggcctttactggggagatcagc
cctggcatgatcaaagactgcggagccacatgggtagtcctggggcactcggaaagaagg
catgtctttggggagtcggatgagctgattggacagaaagtggcccacgccctggcagag
ggactcggagtaattgcctgcattggggagaagctagatgagagggaagctggcatcact
gagaaggttgttttcgagcaaaccaaggtcatcgcagataacgtgaaggactggagcaag
gttgtcctggcctatgagcctgtatgggccattgggactggcaagactgcaacaccccaa
caggcccaggaagtacatgaaaagctccggggatggctcaagtccaacgtctctgatgca
gtggctcagagcacccgtatcatttacggaggttctgtgactggagcaacctgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggtggggcttccctcaagcctgag
tttgtggatatcatcaacgccaaacaataa

DBGET integrated database retrieval system