KEGG   Canis familiaris (dog): 477753
Entry
477753            CDS       T01007                                 

Gene name
ALOX5
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00590  Arachidonic acid metabolism
cfa01100  Metabolic pathways
cfa04664  Fc epsilon RI signaling pathway
cfa04726  Serotonergic synapse
cfa04913  Ovarian steroidogenesis
cfa05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    477753 (ALOX5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    477753 (ALOX5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    477753 (ALOX5)
  09156 Nervous system
   04726 Serotonergic synapse
    477753 (ALOX5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    477753 (ALOX5)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     477753 (ALOX5)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 477753
NCBI-ProteinID: NP_001192042
Ensembl: ENSCAFG00000006948
VGNC: 37813
UniProt: E7ECW0
Position
28
AA seq 676 aa
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGDIQLVKIEKRKYWLHDDWYLKYITLKTPCGDYIEFPCYRWITGEGEIVLRDGRAKLA
CDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWSDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIQRCKKLPEKLPVTTEMVECSLERQLTLEQEVEQGNIFIVDFDLLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQVPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HIHQTITHLLRTHLVSEVLVFGIAMYRHLPAVHPIFKLLVAHVRFTIAINTKAREQLICE
YGLFDKANATGGGGHVQMVQRAMQDLTYISLCFPEAIKARGMDSTEDIPYYFYRDDGLLV
WEAIKTFTAEVVGIYYKSDQMVVEDQELQDFVKDVYVYGMRGKKTSGFPKSIKTREKLSE
YLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRS
CWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAIARFHKNLDTIVSMIAERNKNKKL
PYYYLSPDRIPNSVAI
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgccgtcctacacggtcaccgtggccaccggcagccagtggttcgctggcaccgacgac
tacatctacctcagcctcgtgggctccgccggctgcagcgagaagcacctgctggacaag
cccttctacaacgactttgagcgcggcgcggttgattcttatgatgtgaccgtagatgaa
gaactgggcgacatccaactggtcaaaatcgagaagcgtaagtattggctccatgacgac
tggtacctaaagtatatcacgctgaagacgccctgtggagattacatcgagttcccttgc
taccgctggatcactggtgagggcgagattgtcctgagagatggacgtgcaaagttggcc
tgcgatgaccaaattcacatcctcaagcagcacagacgtaaagagctggaaacacggcaa
aaacagtatcggtggatggagtggaaccctggcttccctttgagtattgatgccaaatgt
cacaaggatttaccccgagacatccagtttgatagcgagaagggtgtggacttcgttctg
aactactctaaagcgatggagaacctgttcatcaaccgcttcatgcacatgttccagtct
tcttggagtgacttcgctgattttgagaagatcttcgtcaagatcagcaacactatttct
gagcgtgtcatgaaccactggcaggaagacctcatgtttggctaccagttcctgaatggc
tgcaacccagtgttgatccagcgctgcaagaagctacccgagaagctccctgtgaccaca
gagatggtggagtgcagtctggagcggcagctcaccttggagcaagaggtcgagcaagga
aacatcttcatcgtggactttgacctgctggatggtatcgatgccaacaaaacagacccc
tgtactctgcagttcctggcagcgcccatctgcttgctgtacaagaatctggccaacaag
attgtccccattgccatccagctcaaccaagtcccaggagatgaaaacccaatttttctc
ccttcggatgcaaaatatgactggcttctggccaaaatctgggtgcgctccagtgacttc
cacatccaccagaccatcactcaccttctgcgcacacatctggtgtctgaagtcttggtc
tttggcattgccatgtaccgccacctgcccgcagtgcaccccattttcaagcttctggtg
gcacacgtgcggttcaccattgccatcaacaccaaggcccgtgaacagctcatctgcgag
tatggactctttgacaaggccaacgccacagggggcggtggacacgtgcagatggtgcag
agggccatgcaggacctgacctacatctccctgtgcttccccgaggccatcaaagctcgg
ggaatggacagcacagaggacattccctactacttctaccgggatgacgggctcctggtg
tgggaggccatcaagacgttcacggccgaggtggtaggcatctactacaagagtgaccag
atggtggtagaggaccaggagctgcaggactttgtgaaggatgtttatgtgtacggcatg
cggggcaagaagacctcaggtttccccaagtccatcaagaccagagagaagctgtcggag
tacctaacagtagtgatcttcacggcctcagcccagcatgcagcggtgaacttcggccag
tatgactggtgctcctggatccccaatgcccccccaaccatgcgggccccaccaccgacg
gccaagggtgtcgtcaccatcgagcagattgtggacacgctgccagaccgtggccgctcc
tgctggcatctgggcgcagtatgggcactgagccagtttcaagaaaatgagctgttcctg
ggcatgtatccagaagagcatttcatcgagaagcctgtaaaagaggccattgcccggttc
cacaagaaccttgacaccatcgtcagcatgattgctgagcgcaacaagaacaagaagctg
ccatattattacttgtccccagaccggattcccaatagtgtagccatctaa

DBGET integrated database retrieval system