KEGG   Canis familiaris (dog): 477876
Entry
477876            CDS       T01007                                 

Gene name
RB1CC1
Definition
(RefSeq) RB1-inducible coiled-coil protein 1 isoform X1
  KO
K17589  RB1-inducible coiled-coil protein 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04140  Autophagy - animal
cfa04211  Longevity regulating pathway
cfa05010  Alzheimer disease
cfa05016  Huntington disease
cfa05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    477876 (RB1CC1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    477876 (RB1CC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    477876 (RB1CC1)
   05016 Huntington disease
    477876 (RB1CC1)
   05017 Spinocerebellar ataxia
    477876 (RB1CC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfa01009]
    477876 (RB1CC1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    477876 (RB1CC1)
   03029 Mitochondrial biogenesis [BR:cfa03029]
    477876 (RB1CC1)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     477876 (RB1CC1)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    477876 (RB1CC1)
Mitochondrial biogenesis [BR:cfa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    477876 (RB1CC1)
SSDB
Motif
Pfam: ATG11 TBK1_ULD Jag_N NPBW
Other DBs
NCBI-GeneID: 477876
NCBI-ProteinID: XP_013964716
Ensembl: ENSCAFG00000006819
VGNC: 45390
Position
29
AA seq 1593 aa
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIHSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LAVEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEGSEKAEMKTSTEL
VLSPDMPRATNQSLLTSFHKSVEHIAPDTTDAEIGKEIRESCQNTVQQDETSVDAKDGDL
PFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMKA
IKGLEDRLYALDQMIASCSRLVNEQKELAQGFLANQMRAENLKDASVLPDLCLSHANQLM
IMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLE
RVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGKL
FRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPL
LCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASISQTSPQSASSPRIESTTG
IATTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLDL
DSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTN
ICGKEDLGDHTSLNVQLERCRVVAQDSNFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCTA
LEIRNIIEKVKYSLEITLSEKHQKELQSLKSEYEGKLDALIKESEENENKIKKLKGDLVC
LEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHTQNCEINELKQSREIVLED
LKKLHVENDEKMQLLRTELQCLEQSHLKELEDTLQFRHTQEFEKVMTDHRVSLEKLKKEN
QQRIDQIQESHATVIQEKEQQLQELKLKVSDLSDMRCKLEVELALKEAETDEIKILLEES
RAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISELI
SRHEEESDMLKAELNKVTSLHQQAFEIEKNLKEEIVELQSKLDAELSALEKQKDEKLTQQ
EEKYEAIIQKLEKDREKFVMSKEQDREQLIQKLNCEKEEAIQTALKEFKLEKEAVEKELL
EKVKHLEDQIAKSLAIESTREDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVR
TSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEE
KKKLEEEVSKLRSSSFVPSAYVAAAPELYGACAPELPGETERSAMETQDEGKVDSAMETS
MMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDF
QVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVME
KEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
NT seq 4782 nt   +upstreamnt  +downstreamnt
atgaagttatatgtatttctggttaacactggaactaccctgacatttgacactgaactt
acagtgcaaactgtggcagacctcaagcatgccattcatagcaaatacaagattgcaatt
cagcatcaggtgctggtggtaaatggaggagaatgcatggctgcagatcgaagagtgtgc
acctacagtgctgggacggacacaaatccaatttttctttttaacaaagaaatgatctta
tgtgatcgtccacctgctattccgaaaactaccttttcaacagaaaatgacatggaaata
aaagttgaagagtctcttatgatgcctgcagtttttcacacagttgcttcaaggacacaa
cttgcagtggaaatgtatgaagttgccaagaaactttgctctttctgtgaaggtctggtc
catgatgaacatcttcaacaccaaggctgggctgcaatcatggccaatctggaggactgt
tcaaattcataccaaaaactacttttcaagtttgaaagtatttattcaaattatctgcaa
tccatagaagacatcaagttaaaacttactcatttaggaactgcggtttcagtaatggcc
aagattccactgttggagtgcctaaccagacatagttacagggaatgtttgggaagactg
gattctttacctgaacatgaaggctcagaaaaggctgaaatgaaaacctccactgaactg
gtgctttctcctgatatgcctagagcaactaaccaatccttgttaacctcatttcacaag
tcagtggaacatatagccccagataccacagatgctgaaattggaaaagaaattagggaa
tcttgtcaaaatactgtccagcaggatgaaacttcagtagatgctaaagacggtgatctg
cctttttttaatgtttctttgttagactggataaatgttcaagatagacctaatgatgtg
gaatcgttggtcaggaaatgctttgattccatgagcagacttgatccaaggattattcga
ccatttatagcagagtgccgtcaaactattgccaaacttgataatcagaatatgaaagcc
attaaaggacttgaagaccggctctatgccctggaccagatgattgctagctgcagccga
ctagtgaatgaacagaaggaacttgctcagggatttttagctaatcagatgagagctgaa
aacttgaaggatgcatctgtattacctgatttgtgcctgagtcatgcaaatcagttgatg
attatgttgcaaaatcatagaaaactgttggatattaaacagaagtgtaccactgccaaa
caagaactagctaataacctacatgtcagactgaagtggtgttgctttgtaatgcttcat
gctgatcaagatggagagaaattacaagctttgctccgccttgtgatagaactgttagaa
agagtcaaaattgttgaagctcttagtacagttcctcagatgtactgcttagctgttgtt
gaggttgtaaggagaaagatgttcataaaacactacagggagtgggctggtgctttagtc
aaagatggaaagcgattatatgaagctgaaaagtcaaaaagggaatcctttgggaaatta
tttaggaagtcctttttaagaaatcgtctgtttaggggattggactcctggcccccatcc
ttttgtactcagaagcctcgaaagtttgactgtgaacttccagatatttcattaaaagat
ttacagtttctgcaatcattttgtccttcagaagttcagccattcctcagggttccctta
ctttgtgactttgaacctcttcaccagcatgtactcgctctacataatttggtaaaagca
gcacaaagtttggatgaaatgtcacagaccattacagatctactgagtgaacaaaaggca
tccataagtcagacatccccacagtcggcttcctcaccaaggatagaaagtacaacagga
atcgcaactactacctcaccgagaactcctcctccacttactgttcaggatcccttatgt
cctgcagtgtgtcccttagaagaattatctccagatagcattgatgcacatacatttgat
tttgaaactatcccccatccaaacatagaacagactattcaccaagtttcattagacttg
gattcattagcagaaagtcctgaatcagattttatgtctgctgtaaatgagtttgtaata
gaagaaaatttatcatctcctaatcctataagtgatccacagagtccagaaatgatggtg
gaatcactttattcatcagttatcaatgcaatagacagtagacggatgcaggatacaaat
atatgtggtaaagaggatttaggagatcatacttctctaaatgtccaattggaaagatgt
cgagttgttgcccaagactcgaatttcagtatacaaaccatcaaggaagacctctgccac
ttcagaacatttgtacaaaaagaacagtgtgacttctcaaattctttaaaatgtacagca
ttagaaataagaaacattattgagaaagtaaaatattctctggaaataacactaagtgaa
aaacatcaaaaagaactgcagtctttaaaaagtgaatatgaaggcaagcttgatgcacta
ataaaggagagtgaagaaaatgaaaacaaaattaaaaagctgaaaggagatttggtatgc
cttgaggaggttttacaaaataaagataatgaatttgctttggttaaacatgaaaaagaa
gctgtcatctgcttgcaaaatgaaaaggatcagaagttgttagaaatggaaaatataatg
cacactcaaaattgtgaaattaatgaactgaaacagtcacgagagatagtattagaagac
ttaaagaagctccatgttgaaaatgatgagaagatgcagttgttgcggacagaacttcag
tgcttagagcaaagtcatctaaaggagttagaggacactctgcagtttaggcacacacag
gagtttgagaaagttatgacagaccacagagtgtctttggagaaattaaaaaaggaaaat
caacaaagaattgaccagatacaagagtctcatgccacagttatccaggagaaagaacaa
cagctacaggaattaaaactcaaagtttctgatttgtcagacatgagatgtaagttagag
gttgaacttgcattgaaggaagcagaaactgatgaaatcaaaattttgctagaagaaagc
agagcccagcagaaggagaccctaaaatctctccttgaacaagagacagaaaatttgaga
acagagataagtaaactaaaccaaaagattcaggataataatgaaaactatcaggtgggt
ttggcagagctaagaactttaatgacaattgaaaaagatcagtgcatttcagagttaatt
agtagacatgaagaagaatctgatatgcttaaagctgaattaaacaaagtaacatcattg
catcagcaagcatttgaaatagaaaaaaacctgaaagaagaaatagttgaactgcagagt
aaattggatgcagaattgagtgctcttgaaaaacaaaaagatgaaaaactcacccaacag
gaagagaagtatgaagctattatccagaaacttgagaaggacagagagaagtttgtcatg
agcaaggagcaagacagagaacagttaattcagaagcttaattgtgaaaaagaagaagct
attcagactgccttaaaagagtttaaattggagaaagaagctgttgagaaagagttatta
gagaaagttaaacatcttgaggatcaaatagcaaaaagtcttgccattgaatctaccaga
gaagattcttcaagcctagttgctgaacttcaagaaaagcttcaggaagaaaaagcaaag
tttttagaacaacttgaagagcaagagaaaagaaagaatgaagaaatgcaaaatgttcga
acatctctgattgctgaacaacagaccaattttaacactgttttaacaagagagaaaatg
agaaaagaaaatataatcaatgatcttagcgataagctgaaaagtacaatgcaacagcaa
gagcgagataaagatttgatagagtcactctctgaagatcgagctcgtttgcttgaggaa
aagaaaaaacttgaagaagaagtcagtaagttgcgtagtagcagttttgttccttcagca
tacgtagctgcagccccagaactttatggagcttgtgcacctgaactcccaggtgaaaca
gagagatcagcaatggaaacacaagatgaaggaaaagtggattcagcaatggagacaagt
atgatgtctgtacaagaaaatatccatatgctatctgaagaaaaacagagaataatgctg
ttagaacgaacattacagttgaaagaagaagaaaacaagcgattaaatcaaagactgatg
tctcagagcatgtcttccgtatcctcaaggcattctgaaaaaatagctattagagatttt
caggtgggagatttggtactcatcatcctagacgagcgccatgacaattatgtattattt
actgttagtccaaccttgtattttctgcattcggagtctctgcctgccctggatctcaaa
ccaggtgagggtgcttcaggtgcatcaagaagaccgtgggtacttggaaaagtaatggaa
aaggaatactgtcaagccaaaaaggcacaaaacagatttaaagttcctttggggacaaag
ttttacagagtgaaagctgtgtcatggaataagaaagtataa

DBGET integrated database retrieval system