KEGG   Canis familiaris (dog): 477936Help
Entry
477936            CDS       T01007                                 

Gene name
RIPK2
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 2 isoform X1
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04621  NOD-like receptor signaling pathway
cfa04722  Neurotrophin signaling pathway
cfa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    477936 (RIPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    477936 (RIPK2)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    477936 (RIPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    477936 (RIPK2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     477936 (RIPK2)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   477936 (RIPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase CARD Kdo
Motif
Other DBs
NCBI-GeneID: 477936
NCBI-ProteinID: XP_005638158
Ensembl: ENSCAFG00000008959
VGNC: 45595
UniProt: E2QUD1
Position
29
AA seq 538 aa AA seqDB search
MNREGPRCALPTIPCRKLADLRYLSRGASGTVSSARHADWRVQVAVKQLHIHSPLRDSER
NDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRTMSLSQSRT
SKSSPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVITWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTNEESLPLDIPHRALMISLIESGWAQNPDERPSFLKCLIQLEPVLRTFEEI
TFLEAVIQLKKTKLQSALSTLHLCDKKEMESSLNIPVTHGPQEESCGSSQPHENSVSTGA
SESLSAPQDNNFLSRKTQDFSPVCHYPVNHSCNSNISAAQKWTFCDHKTTPCALTVINPF
SAEGNTERLQPGIAQQWIQSKREDIVSQMTEACLNQSLDALLSRDLIMKEDYELVSTKPT
RTSKVRQLLDTSDIQGEEFARIIVQKLKDNKQMGLQPYPEILVVSRSQPLNSFQNKNL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggagggcccccgttgcgccctgcccaccatcccctgccgcaagctcgccgac
ctgcgctacctgagccgcggcgcgtcgggcaccgtgtcgtccgcccgccacgcggactgg
cgcgtgcaggtggccgtgaagcagctgcacatccacagcccgctgcgcgacagtgaaaga
aatgatgttttaagagaagctgaaattttacacaaagctagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggaatagttacggaatacatgccaaat
ggatcattaaatgaactcctacacaggaaaacagaatatcctgatgttgcttggccactg
agatttcgtatcctgcatgaaattgcactaggggtaaactatctgcacaatatgaatcct
cctctacttcatcatgacttgaagactcaaaatatcttattggataatgaattccatgtt
aagatcgcagattttggtttatcaaaatggcgtacgatgtccctctcacaatcacgaact
agtaaatcttcaccagaaggagggacaattatctatatgccacctgagaactatgaacct
ggacaaaaatcaagggccagtgtcaagcatgatatatatagctatgcagtgatcacatgg
gaagtcttatccagaaaacagccttttgaagaagtcaccaatcctttgcagatcatgtat
agtgtatcacaaggacatcgaccaaacactaatgaagaaagtttgccacttgatatacct
catcgagcacttatgatctctctaatagaaagtggatgggcacaaaatccagatgaaaga
ccatctttcttaaaatgtttaatacaacttgaaccagttctcaggacatttgaagagata
acttttcttgaagctgttattcaactaaagaaaacaaagttacagagtgctttgagcact
cttcacttatgtgacaagaaggaaatggagtcttctctgaacatacctgttactcatgga
ccacaggaggaatcgtgtggatcctctcagccccatgaaaatagtgtttctactggagcc
tcggaatccctgtcagctcctcaagataataattttttatctagaaaaactcaagacttt
tctccggtgtgtcactatccagtaaatcacagttgcaatagtaacatctctgcagctcag
aagtggacgttttgtgatcacaagaccaccccatgcgcgttaacagtaataaatccattc
tcagctgagggaaacacagagcgattacagcctggcatagcccagcagtggatccagagt
aaaagggaagacattgtgagccagatgacagaagcctgccttaaccagtcgctagatgct
ctcctgtccagggacttgatcatgaaggaggactatgaactcgttagtactaaacctaca
aggacctcaaaagtcagacagttactggacaccagtgacatccaaggagaagaatttgcc
agaattatagtacaaaagttgaaagataacaagcaaatgggtcttcagccttacccggaa
atacttgtggtttctcgatcacaacctttaaattcatttcaaaataaaaacttataa

DBGET integrated database retrieval system