KEGG   Canis familiaris (dog): 477936Help
Entry
477936            CDS       T01007                                 

Gene name
RIPK2
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 2 isoform X1
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04621  NOD-like receptor signaling pathway
cfa04722  Neurotrophin signaling pathway
cfa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    477936 (RIPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    477936 (RIPK2)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    477936 (RIPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    477936 (RIPK2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     477936 (RIPK2)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   477936 (RIPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase CARD Kdo
Motif
Other DBs
NCBI-GeneID: 477936
NCBI-ProteinID: XP_005638158
Ensembl: ENSCAFG00000008959
VGNC: 45595
UniProt: E2QUD1
Position
29
AA seq 538 aa AA seqDB search
MNREGPRCALPTIPCRKLADLRYLSRGASGTVSSARHADWRVQVAVKQLHIHSPLRDSER
NDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRTMSLSQSRT
SKSSPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVITWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTNEESLPLDIPHRALMISLIESGWAQNPDERPSFLKCLIQLEPVLRTFEEI
TFLEAVIQLKKTKLQSALSTLHLCDKKEMESSLNIPVTHGPQEESCGSSQPHENSVSTGA
SESLSAPQDNNFLSRKTQDFSPVCHYPVNHSCNSNISAAQKWTFCDHKTTPCALTVINPF
SAEGNTERLQPGIAQQWIQSKREDIVSQMTEACLNQSLDALLSRDLIMKEDYELVSTKPT
RTSKVRQLLDTSDIQGEEFARIIVQKLKDNKQMGLQPYPEILVVSRSQPLNSFQNKNL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgggagggcccccgttgcgccctgcccaccatcccctgccgcaagctcgccgac
ctgcgctacctgagccgcggcgcgtcgggcaccgtgtcgtccgcccgccacgcggactgg
cgcgtgcaggtggccgtgaagcagctgcacatccacagcccgctgcgcgacagtgaaaga
aatgatgttttaagagaagctgaaattttacacaaagctagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggaatagttacggaatacatgccaaat
ggatcattaaatgaactcctacacaggaaaacagaatatcctgatgttgcttggccactg
agatttcgtatcctgcatgaaattgcactaggggtaaactatctgcacaatatgaatcct
cctctacttcatcatgacttgaagactcaaaatatcttattggataatgaattccatgtt
aagatcgcagattttggtttatcaaaatggcgtacgatgtccctctcacaatcacgaact
agtaaatcttcaccagaaggagggacaattatctatatgccacctgagaactatgaacct
ggacaaaaatcaagggccagtgtcaagcatgatatatatagctatgcagtgatcacatgg
gaagtcttatccagaaaacagccttttgaagaagtcaccaatcctttgcagatcatgtat
agtgtatcacaaggacatcgaccaaacactaatgaagaaagtttgccacttgatatacct
catcgagcacttatgatctctctaatagaaagtggatgggcacaaaatccagatgaaaga
ccatctttcttaaaatgtttaatacaacttgaaccagttctcaggacatttgaagagata
acttttcttgaagctgttattcaactaaagaaaacaaagttacagagtgctttgagcact
cttcacttatgtgacaagaaggaaatggagtcttctctgaacatacctgttactcatgga
ccacaggaggaatcgtgtggatcctctcagccccatgaaaatagtgtttctactggagcc
tcggaatccctgtcagctcctcaagataataattttttatctagaaaaactcaagacttt
tctccggtgtgtcactatccagtaaatcacagttgcaatagtaacatctctgcagctcag
aagtggacgttttgtgatcacaagaccaccccatgcgcgttaacagtaataaatccattc
tcagctgagggaaacacagagcgattacagcctggcatagcccagcagtggatccagagt
aaaagggaagacattgtgagccagatgacagaagcctgccttaaccagtcgctagatgct
ctcctgtccagggacttgatcatgaaggaggactatgaactcgttagtactaaacctaca
aggacctcaaaagtcagacagttactggacaccagtgacatccaaggagaagaatttgcc
agaattatagtacaaaagttgaaagataacaagcaaatgggtcttcagccttacccggaa
atacttgtggtttctcgatcacaacctttaaattcatttcaaaataaaaacttataa

DBGET integrated database retrieval system