KEGG   Canis familiaris (dog): 477999Help
Entry
477999            CDS       T01007                                 

Gene name
SEPHS1
Definition
(RefSeq) selenide, water dikinase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00450  Selenocompound metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    477999 (SEPHS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfa03016]
    477999 (SEPHS1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     477999 (SEPHS1)
Transfer RNA biogenesis [BR:cfa03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    477999 (SEPHS1)
 Prokaryotic Type
    477999 (SEPHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 477999
NCBI-ProteinID: NP_001177339
Ensembl: ENSCAFG00000004743
VGNC: 46009
UniProt: F1PFD8
Position
2
AA seq 392 aa AA seqDB search
MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQVATQNVNPTPGATS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgcgggagtcctttaacccggaaagttatgaattggacaagagcttccggcta
accagattcactgaactgaagggcaccggctgcaaagtgccccaagatgtcctgcagaaa
ttgctggaatccttacaagagaatcacttccaagaagatgagcagtttctgggagcagtt
atgccaaggcttggcattggaatggatacttgcgtcattcctttgaggcatggcggtctt
tctttggttcaaaccacggattacatttaccccatcgttgatgacccttacatgatgggc
aggatagcatgtgccaacgtcctcagtgacctctacgccatgggggtcacggaatgtgac
aatatgctgatgctccttgggatcagtaataaaatgactgacagggagagggataaagtg
atgcccctaattatacagggttttaaagatgcagcagaggaggcgggaacgtctgtgact
ggtggccaaacggtgttaaacccctggattgttctaggaggagtggctactactgtctgc
cagcccaatgaattcatcatgccagataatgcagtcccgggggatgtgctggtgctgacg
aagcccctggggacgcaggtggctgtggctgtgcaccagtggctggacattcctgaaaaa
tggaataagatcaagctagtggtcacccaagaagatgtagagttggcgtaccaggaggcg
atgatgaacatggccaggctcaacagaacagctgcaggactcatgcacacgttcaatgcc
cacgctgccaccgacatcacgggctttgggattttggggcacgcacagaacctagccaag
cagcagaggaacgaggtgtccttcgtgattcacaacctccctgtcctggccaagatggct
gctgtgagcaaggcctgtggaaacatgtttggcctcatgcatgggacctgcccagagaca
tcaggaggcctcctcatctgtttaccacgagagcaagccgcccggttctgtgcagagatc
aagtctcccaaatatggggagggccatcaggcatggattattgggatcgtggagaaaggc
aaccgcaccgccagaatcatagacaagccccggatcatcgaagttgcaccgcaggtggcc
actcagaacgtgaaccccaccccgggtgccacctcttaa

DBGET integrated database retrieval system