KEGG   Canis lupus familiaris (dog): 478257
Entry
478257            CDS       T01007                                 

Gene name
EIF2AK4
Definition
(RefSeq) eIF-2-alpha kinase GCN2 isoform X2
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04140  Autophagy - animal
cfa04141  Protein processing in endoplasmic reticulum
cfa05160  Hepatitis C
cfa05162  Measles
cfa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    478257 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    478257 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    478257 (EIF2AK4)
   05160 Hepatitis C
    478257 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    478257 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    478257 (EIF2AK4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     478257 (EIF2AK4)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   478257 (EIF2AK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like Kdo APH PIEZO
Other DBs
NCBI-GeneID: 478257
NCBI-ProteinID: XP_005638286
Ensembl: ENSCAFG00000008775
VGNC: 40259
UniProt: A0A5F4BQ65
Position
30
AA seq 1600 aa
MAGGRGAPGRGRDEPPESYPQRQEHELQALEAIYGADFQDLRPDARKSVNEPPEINLVLY
PQGLTGEEVYVQVDLRVKCPPTYPDVVPEIELKNAKGLSNESVHLLKSHLEKVAKKHCGE
QREILHEIQRRKEEIKEERKRKEMAKQERLEIASLSNQDQNSRKDPGGHRISAILHGGSP
DFVGNGKHRTNSSGRSRRERQYSLCSSEDSSGSCEVLYFSMGSPDQLMVYKGRCIGSDEQ
LGKLVYNALETATGNFVSLHEWVLRWQKKMGPFLTSQEKEKIDKCKKQIQGAETEFNSLV
KLSHPNVVRYFAMNLKEQDDSIMVDILLEHINGVSLSAHLSHSGPIPVYQLRKYTAQLLS
GLDYLHSNDVVHKVLNASNVLVDAEGNVKITDYSISKRLADICKEDVFEQSRVSFSDSAL
PYKTGKKGDVWCLGLLLLFLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQ
QLLKHSFINPQPKMSLLEQSPDDSGGQDYVETVIPSKQLPSAAFFSETQRQFSRYFIEFE
ELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRY
YNAWIERYERPVGPGMLPQDSDSWPQAPDGRALSQPSPGNDSPDGDGAGSVEAAAPPPIL
SSVEWSTSGERSASARFPSARPGSSSEEDDDDDEHEGVFSQPFLPASDSDSDVIFEDENS
KSQNQEEDCNGKNSCHESEPSTTTEAVHYLYIQMEYCEKSTLRDTIDQGLYQDTIRLWRL
FREILDGLAYIHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFTADGKQDDTADH
LIKSDPSGHLTGMVGTALYVSPEVQGSSRPTYNQKVDLFSLGIIFFEMSYHPMVTASERI
FVLNQLRDPTSPKFPEDFDDGEHTKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEE
SELHEVLHHTLANVDGKAYRTMMAQIFSQRVSPAIDYTYDSNMPKGFSIRTSKIQQHVCD
TIVRIFKKHGAVQLCTPLLLPQNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARN
NILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAEVIYTICEIIQEFP
ALQERNYSIYLNHTMLLKAIFLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSL
SSNSLCRLYKFIEQKGDLQDLTPAINSLIKQKTGVAQLVKYGLKDLEEIIGLLKKLGIKL
QVLINLGLVYKVQQHNGVIFQFVAVIRRRQRAISEILAAGGRYDLLIPQFRGPQALGPVP
TAVGVSIAIDKISAAILNMEEPVTISSCDLLIVSVGQMSMSRAINLTQKLWSAGITAQIM
YDWSQSQEELQEYCRYHEITYVALVSDKGGSYVKVKSFEKERQTEKLVQESDLIDHVLQK
LRTKVSDERTIREASDNLAVQNLKGSFSNASGLFEIHGAAVVPIVSVIAPEKLSASTRRR
YETQVQTRLQTSLANLHQKSNEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSR
LPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4803 nt   +upstreamnt  +downstreamnt
atggctgggggccgtggggcccccgggcgcggccgggacgagcctccggagagctacccg
cagcggcaggagcacgagctgcaggccctggaggccatctacggcgccgacttccaggac
ctgcggccggacgcgcgcaaatcggtcaacgagccccctgaaatcaacttagttctgtac
cctcagggcctaactggtgaagaagtatacgtgcaagtggatttgagggttaaatgccca
ccaacctacccagatgtagtccctgaaatagagttaaagaatgccaaaggtctatcaaat
gaaagtgttcatttgttaaaatcccacctagagaaagtggccaaaaaacattgtggagag
caacgtgaaatccttcatgagattcaaagaaggaaagaagagataaaagaagagagaaaa
agaaaagaaatggctaagcaggagcgtttggaaattgctagtttgtcaaaccaagatcaa
aactctaggaaagacccaggaggacacagaatatctgccattctacatggaggctctcct
gactttgtaggaaatggtaaacatcggaccaactcctctggaaggtctaggcgagaacgt
cagtattctctgtgtagtagtgaagattcttctggctcttgtgaagtcctgtatttctct
atgggtagccctgatcagctcatggtttacaaagggaggtgcattggcagtgatgagcag
cttggaaaattagtttataatgctttggaaacggccactggcaactttgtgtcattacat
gagtgggtccttcggtggcagaaaaaaatgggcccgttccttaccagtcaagagaaggag
aagattgataagtgcaaaaagcagattcaaggggcagaaacggaattcaactcactggta
aaattgagccatccaaatgtagtacgctactttgcaatgaatctcaaagagcaagatgac
tccatcatggtggacattttattggagcacattaatggggtctccctctctgcacatctg
agccactcaggccccatccctgtgtatcaactccgcaagtacacagctcagctcttgtct
ggcctcgattatttgcacagcaatgacgtggtgcacaaggttctgaatgcatcaaatgtc
ttggtggatgcagagggcaatgtcaagattacggactacagcatttcaaagcgcctagca
gacatttgcaaggaggatgtgtttgagcagagccgagttagttttagtgacagtgcccta
ccttataaaacggggaagaaaggggatgtttggtgtcttggccttctgctgctcttcctc
agccaaggacaagaatgcggagagtaccctgtgaccatccctagcgacttaccagctgac
ttccaagattttctaaagaagtgtgtttgcttggatgacaaggaaagatggagtccccag
caattgttgaaacacagctttatcaatccacagccgaaaatgtctttattggaacagagt
cctgacgattctggaggacaagattatgttgagactgttattcctagtaagcagctaccc
agtgcagcattcttcagtgagacacagagacagttttcccggtatttcattgagtttgaa
gaattacagcttctcggcaaaggagccttcggagctgtcatcaaggtgcagaacaagctg
gatggctgctgctacgcggtgaagcgcatccccatcaatccggccagtaggcatttccgc
aggatcaagggcgaggtgacgctgctgtcgcgcctgcaccacgagaacatagtgcgctac
tataacgcctggatagagagatacgagcggcccgtgggcccggggatgctgccgcaggac
tcggactcatggccccaggcaccggatgggcgagctttgtcccagccgtccccaggcaac
gacagccccgacggcgacggcgccggtagcgtggaggccgctgcgccaccgcccatcctc
agctcggtggagtggagcacatctggcgagcgttcggccagcgcccgcttcccctccgcc
cgcccaggctccagcagcgaggaggacgacgacgacgacgagcacgagggcgtcttctcc
cagcccttcctacctgcttcagattctgacagtgatgtcatctttgaagatgagaacagt
aagagtcagaatcaggaagaagactgcaatgggaagaacagttgccatgaaagtgagcca
tcgacaaccactgaagctgtgcactacctgtatatccagatggagtactgtgagaagagt
actttgcgtgacaccattgaccaggggctatatcaagataccatcagactctggaggctt
tttcgagagattctggatggattagcttatatccatgaaaaaggaatgattcaccgggat
ttgaagcctgtcaacatctttttggattctgatgaccatgtaaaaataggtgattttggt
ttagcgacagaccatcttgccttcactgctgatggcaagcaagatgatacagcagatcac
ttgattaaatcagacccctcaggtcatttgactgggatggttggtactgctttatacgta
agcccagaggtccaaggaagcagcagacccacgtacaaccagaaagtggatctcttcagc
ctgggaattatcttctttgagatgtcctatcaccccatggtcacggcctcagaaaggatc
tttgttctcaaccaactcagagatcccacttcacctaagtttccagaagacttcgatgat
ggagagcatacaaagcagaaatctgtcatctcctggctgttgaaccatgatcccgccaag
cggcccacagccacagagctgctcaagagtgagctgctgcccccaccccagatggaggag
tcagagttgcatgaggttctgcaccacaccctggccaacgtggatgggaaggcctaccgc
accatgatggcccagatcttctcccagcgcgtcagtccagccatcgattacacctatgac
agcaacatgccgaagggcttttcaatccgtacatccaagatacagcaacatgtgtgtgat
accatcgtccgcatttttaaaaaacacggagctgtccagttgtgtactccactactgctt
ccccaaaataggcaaatatacgagcacaatgaagctgccttattcatggaccacagcggg
atgctggtgatgcttccctttgacctacgggttccttttgcaagatatgtggcaagaaat
aatatattgaatttgaaacgttactgcatagaacgtgtcttcagacctcgcaagttagac
cgatttcatcccaaagaacttctggaatgtgcatttgacattgttacgtctaccaccaac
agctctctgcccactgctgaagtcatctacacgatctgtgagatcatccaggagttcccg
gcactgcaggaaagaaattacagtatttacttgaaccacaccatgttattgaaagcaatc
ttcttacactgtgggatcccagaagataaactcagtcaagtctatgttattctatatgat
gcagtgacagaaaagctgacaaggagagaagtggaagccaagttttgtaatctgtctctg
tcatctaatagtctgtgtcgactctacaaattcattgagcagaagggagatttgcaagat
ctaacaccagcaataaattcattaataaaacagaaaacaggtgttgcccaactggtgaag
tatggcttgaaagacttagaggagatcattgggctgttgaagaaactcggcatcaagtta
caggtcttgatcaacttgggcttggtttacaaagtacagcagcacaacggagtcatcttc
cagtttgtggcggtcatcagacggaggcaaagggctatttcagaaatccttgcagctgga
ggcagatacgacctgctgattccccagtttagaggaccgcaggctctgggaccagtcccg
actgctgttggggtcagcatagccatagacaagatatctgcagctatcctcaacatggaa
gaacctgttacaataagctcttgtgacctcctgatcgtaagtgttggccagatgtccatg
tccagggccatcaacctaacccagaaactttggtcagcaggaatcacagcacagatcatg
tacgactggtcacagtcccaagaagaactccaggaatactgcagataccacgaaatcacc
tacgtggccctcgtctcagataaaggaggaagctatgtcaaggttaagtcttttgagaag
gaaaggcaaacagagaaacttgtgcaggagtctgatcttatagaccacgttttgcagaaa
ctcagaactaaagtcagtgatgaaaggactatcagagaagcttctgataatctcgcagtg
caaaatctgaaggggtccttttctaatgcttcaggtttgtttgaaatccacggagcagca
gttgtccccattgtgagcgtgatagccccagagaagctgtcagccagcacgaggaggcgt
tatgaaactcaggtacaaacacgacttcagacctcccttgccaacttacatcagaaaagc
aatgaaattgaaattttggctgtggatctacccaaagaaacaatcttacagtttttatcg
ttagagtgggatgctgatgaacaggcatttaacacaactgtgaagcagctgctgtcacgc
ctgccaaagcagagatacctcaaattagtctgtgatgaaatttataacatcaaagtagag
aaaaaggtatctgtgctattcctgtatagctacagagatgactactaccgaatcttattt
taa

DBGET integrated database retrieval system