KEGG   Canis lupus familiaris (dog): 478430
Entry
478430            CDS       T01007                                 

Gene name
USO1
Definition
(RefSeq) general vesicular transport factor p115 isoform X1
Organism
cfa  Canis lupus familiaris (dog)
SSDB
Motif
Pfam: Uso1_p115_head Arm_vescicular Uso1_p115_C DUF4407 DUF724 ArsR Mod_r Atx10homo_assoc
Other DBs
NCBI-GeneID: 478430
NCBI-ProteinID: XP_005639121
Ensembl: ENSCAFG00000008449
VGNC: 48176
UniProt: J9P5F1
Position
32
AA seq 970 aa
MNFLRGVMGGQSAGPQHTEAETIQKLCDRVSSSTLLDDRRNAVRALKSLSKKYRLEVGIQ
AMDHLIHVLQTDRSDSEIIGYALDTLYNIISNDEEEEVEENSTRQSEDFGSQFTEIFIKQ
QENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQIILVSPMGVSRLMDLLADSRE
VIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIITEEGNSDGGIVVEDCLILLQNLL
KNNNSNQNFFKEGSYIQRMKPWFDVGDENSGWSAQKVTNLHVMLQLVRVLVSPTNPPGAT
SSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGYQVNQDYFASVNAPSNP
PRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQGEIVSTLLPSTIDATGNSVS
AGQLLCGGLFSTDSLSNWCAAVALAHALQENATQKEQLLRVQLATSIGNPPVSLLQQCTN
ILSQGDKIDRRGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGLIAENLGEE
EQLVQGLCALLLGISIYFNDNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRA
SQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDSIVT
HYKNMIREQDLQLEELKQQISTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKVQLGKDNQ
HQGSYSDKTQVNGIQSEEVGRLREELEELKSNQELLQSQLAEKNSLIENLKSSQTSPGTN
EQSSATASARDSEQIAELKQELATLKSQLNSQSMEITKLQTEKQELLQKTETFAKSVPVP
GESEAGMATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDASNSTIAILQNEK
NKLEMDVTDSKKEQDDLLVLLADQDQKIFSLKNKLKELGHPVEEEDELESGDQDDEEDED
EDDGKDQGHI
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgaatttcctccgcggtgtaatgggcggtcagagcgccgggccccagcacacagaggcc
gagacgattcaaaaactttgtgatagagtatcttcatctactttactggatgatcgaaga
aatgctgtgcgtgctctcaaatcgttatctaagaaataccgcttggaagtgggtatacaa
gctatggaccatcttatccatgttttacaaacagatcgttcggattctgaaataataggt
tatgccttggatacactatacaatataatatctaatgatgaagaagaagaagtagaagaa
aattccacaaggcagagtgaggatttcggaagccagtttacagaaattttcattaagcag
caggaaaatgtcactctcctgttatctttattggaggaatttgatttccatgtccgctgg
cctggtgtgaagcttcttacttctcttttaaaacagctaggacctcaggtgcagcaaatc
attttagtcagtcccatgggtgtttcaagattaatggacttattagcagattccagggaa
gtcatacgtaatgatggtgtattactactgcaggcactaaccagaagcaatggagcaatc
cagaaaattgttgcttttgaaaatgcttttgagagactactggacattattacagaggag
gggaacagtgatggaggtatagtggtagaagattgtctgattttgctccaaaacttgtta
aaaaacaacaattccaatcaaaatttttttaaagaaggctcatatattcaacgtatgaaa
ccttggtttgatgttggagatgaaaattctggctggtctgcgcagaaagtgactaatctg
cacgtaatgctacagctcgttcgtgtactggtatctcccaccaaccctcctggtgccacc
agtagctgccagaaagctatgttccagtgtggcttactgcagcagctctgcactatccta
atggctactggagttcctgctgatatcctgaccgagaccattaatactgtatcagaagtt
attcgaggctaccaagtgaaccaagactactttgcttctgtaaatgcaccttcaaacccc
ccaagaccagcaattgtagtacttctcatgtccatggttaatgaaaggcagccgtttgta
ctgcgctgtgctgttctctattgtttccagtgtttcttatataaaaaccaaaaaggacaa
ggagaaattgtgtcaacgcttctaccttccactattgatgcaacaggtaactctgtctca
gctggtcagttactgtgcggaggtttattttctactgattcactttcaaactggtgtgca
gctgtggcccttgcccatgctttgcaagaaaacgctacccagaaagaacagttgctcagg
gttcagcttgctacaagtatcggcaaccctccagtttctttattacaacagtgcaccaac
atcctttcacagggtgataagatcgacagacggggaagcaaaatacagacaagagttgga
ttattaatgttgctttgtacctggttaagcaactgtcccattgcagtaacacattttctt
cacaattcggccaatgttccatttcttacaggactaattgcagaaaatcttggcgaagaa
gagcagttggtccaaggcttatgtgcccttctgctgggcatttcaatttacttcaatgat
aactcacttgagagctacatgaaagagaaactaaaacaactaatagagaagaggattggc
aaagaaaacttcatagagaagctaggatttattagcaaacatgagttgtattccagagca
tctcagaagccgcagccaaactttcccagtccagaatacatgatatttgatcatgagttt
acgaaactggtaaaagaacttgaaggtgtgataactaaggctatttacaagtccagtgaa
gaggataaaaaagaagaagaggtgaagaaaacattagaacagcatgacagtattgtgact
cactacaaaaatatgattcgagaacaagatctgcaacttgaggaattaaagcagcagatt
tctacattaaaatgtcaaaatgaacagcttcagacagcagtcacacagcaagtatctcag
attcagcaacacaaagatcagtataatcttcttaaagtacagctaggaaaagataatcag
catcaaggttcttacagtgacaagactcaggtgaatggcattcaatcagaagaagtcggt
aggttacgagaagagctagaagaattaaaaagtaaccaggagcttttacaaagccagctg
gctgaaaagaactctctgattgaaaatttgaaatcttcccaaacatcacctggcacaaat
gaacaatcttcagcaacagcttctgctagagattctgaacaaattgcagaattaaaacag
gaactggcaacattaaagtctcagttaaactcacaatctatggagattaccaaactgcag
acagaaaagcaggagctgttacagaaaacagaaacatttgcaaaatcagttcctgtacca
ggagagagtgaagccggaatggccacaaagaccacggatgtagaaggcagattgtcagca
ttattacaggagactaaagagttaaagaatgaaattaaagctctgtctgaggaaagaact
gctattaaagagcagctggatgcatctaacagtaccattgccattttacaaaacgagaaa
aacaagctcgagatggatgttacagattctaaaaaagaacaagatgatctcttggtgctg
ttggctgatcaggatcagaaaatattttcattaaagaataagctcaaagaacttggtcat
ccggtggaagaagaagatgaacttgaatccggagaccaggatgatgaggaggatgaggat
gaagatgatggcaaggaccagggtcacatctag

DBGET integrated database retrieval system