KEGG   Canis familiaris (dog): 478511Help
Entry
478511            CDS       T01007                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00564  Glycerophospholipid metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    478511 (ETNPPL)
Enzymes [BR:cfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     478511 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 478511
NCBI-ProteinID: XP_022269157
Position
32
AA seq 476 aa AA seqDB search
MCELYSKQDILALRRKHIGPSCKVFFAADPVKIVRAQRQYMFDERGDQYLDCINNVAHGK
RPGPVPAVERGRRSITKMCPGRQLSCLNRSEANDLALRLARQFRGHQDVITLDHAYHGHL
SSLIEISPYKFRKGKDVKKEFVHVAPAPDTYRGKYREDHADPANAYADEVKEIIEKAHNS
GRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHRAGGVFIADEVQVGFGRVGKHFWSFQ
MQGEDFVPDIVTMGKPMGNGHPMACVVTTKEIAEAFSSSGMEYFNTYGGNPVSSAIGLAV
LNVIENEDLQGNATRVGDYLTELLNKQKAKHTLIGDIRGIGLFIGIDLVKDRQERTPATD
EAQHVIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDEILTVLEEAIGAK
SESVISENTPCRAKMPNEAHSELLGEGASDPRENPGQKRNGLCTDKHSLLSKRLKT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagctgtacagcaagcaggacatcctggcgctgcggaggaagcacatcgggccc
tcctgcaaagtcttctttgctgcggatcccgtcaaaatagtgcgagcccagcggcagtac
atgtttgacgagcgaggcgaccagtacctggactgcatcaacaacgttgcccacggtaag
cgtcctggtcctgtccctgctgtggagcgaggcagacgcagcatcactaagatgtgcccc
gggcggcagctgagttgtcttaacagatctgaagccaatgacttagcgttacgtttggct
cggcagttcagaggccaccaagatgtgatcactcttgaccatgcttaccatggtcactta
tcatctttaattgagatcagcccatataaattccgaaagggcaaagatgtcaagaaagaa
tttgtgcatgtggcaccagctccagatacttacagaggaaaatacagagaagaccatgca
gacccagccaatgcttatgcagatgaagtaaaggaaattattgaaaaagctcataacagt
gggaggaagattgctgcctttattgctgaatccatgcagagttgtggcggacaaataatt
cctccagcaggctacttccagaaagtggcagagtatgtacacagagcaggaggtgtgttt
attgctgatgaagttcaggtgggctttggccgagttgggaaacatttctggagcttccaa
atgcagggcgaagactttgttccggacatcgtcacaatggggaaaccaatgggcaatggc
cacccaatggcatgcgtggtaacaaccaaagaaatcgcagaagccttcagcagttctggg
atggaatacttcaatacgtatggaggaaatccagtatcttctgctattggtttggctgtc
ctgaatgtaattgaaaatgaagaccttcaaggaaatgccactagagtgggggattatctt
actgagttactcaataaacagaaggctaaacacactttgataggagacatcaggggcatc
ggcctgtttatcggaattgacttggtgaaggaccggcaggaaaggacccccgccacagat
gaagctcaacatgtcatctacaagatgaaagaaaagcgagtccttctcagtgccgacgga
cctcatagaaatgtgcttaaaataaaaccacctatgtgcttcacggaagaagatgcgaaa
tttatggtggaccaactcgatgagatcctaacagttttagaagaagccatcggagccaaa
agtgagagtgtaatctctgagaatactccatgcagagcaaagatgcctaacgaagcacac
tcggaattgcttggtgagggcgcctcggaccccagagaaaatcccggccaaaagagaaat
ggactgtgcacagataaacattccctgctcagtaagaggctcaagacatga

DBGET integrated database retrieval system