KEGG   Canis lupus familiaris (dog): 478514
Entry
478514            CDS       T01007                                 

Gene name
PLA2G12A
Definition
(RefSeq) group XIIA secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00564  Glycerophospholipid metabolism
cfa00565  Ether lipid metabolism
cfa00590  Arachidonic acid metabolism
cfa00591  Linoleic acid metabolism
cfa00592  alpha-Linolenic acid metabolism
cfa01100  Metabolic pathways
cfa04014  Ras signaling pathway
cfa04270  Vascular smooth muscle contraction
cfa04972  Pancreatic secretion
cfa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    478514 (PLA2G12A)
   00565 Ether lipid metabolism
    478514 (PLA2G12A)
   00590 Arachidonic acid metabolism
    478514 (PLA2G12A)
   00591 Linoleic acid metabolism
    478514 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    478514 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    478514 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    478514 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    478514 (PLA2G12A)
   04975 Fat digestion and absorption
    478514 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    478514 (PLA2G12A)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     478514 (PLA2G12A)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    478514 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 478514
NCBI-ProteinID: XP_535693
Ensembl: ENSCAFG00000011462
UniProt: F1Q036
Position
32
AA seq 190 aa
MALLPRRALALLLLLFLPAAALCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGE
DGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGK
SKNDCDEEFQYCLSKICRDVQKTLGLAQHVQACETTVELLFDSVIHLGCKPYLDSQRAAC
RCRYEEKSDL
NT seq 573 nt   +upstreamnt  +downstreamnt
atggccctgctcccgcggcgggcgctcgccctcctgctcctcctcttcctgcccgccgct
gccctgtgtcaggagcaggcccagaccaccgactggcgggccacgctgaagaccatccgc
aacggcgttcacaagatagacacgtacctgaacgccgccttggacctcctgggaggcgag
gacgggctctgccagtacaagtgcagcgacggatctaagcctttcccgcgttatggttat
aaaccctccccaccgaatggatgtggctctccactgtttggtgttcaccttaatattggc
atcccttccctgacaaagtgctgcaaccaacatgacaggtgctatgagacctgtggcaag
agcaagaatgactgcgatgaggaattccagtattgcctctctaagatctgccgggatgtg
cagaaaacactaggactagctcagcatgttcaggcatgtgaaacaacagtggagctcttg
tttgacagtgttatacatttaggctgcaagccatatctggacagccaacgagctgcatgt
aggtgtcgctatgaagaaaaaagtgatctctga

DBGET integrated database retrieval system