KEGG   Canis familiaris (dog): 478631Help
Entry
478631            CDS       T01007                                 

Gene name
SLC6A18
Definition
(RefSeq) sodium-dependent neutral amino acid transporter B(0)AT3
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfa02000]
    478631 (SLC6A18)
Transporters [BR:cfa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   478631 (SLC6A18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 478631
NCBI-ProteinID: XP_535804
Ensembl: ENSCAFG00000010459
VGNC: 46460
UniProt: E2RMQ1
Position
34
AA seq 616 aa AA seqDB search
MACTVGPEPLGDGGGSERPKWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTYGGGAFLIPY
LIALVFEGIPLFYVELAIGQRLRRGSIGVWTAISPYLGGVGLGCVTVSFLVSLYYNTVLT
WVLWYFLNSFQSPLPWSSCPLDVNRTGFEAECQASSTVSYFWYRQTLNITADISDSGSIQ
GRLLACLAASWAVVYLCVIRGIESTGKAIYFTALFPYLVLTIFLIRGLTLPGAVEGLIYL
FTPDVQILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVTIALVNSMTS
LYASIAVFSVLGFKAANDHGRCLDRNILHLINAFDFPDQSISRDDYAAVLTHLNASQPER
VARLHLEACHLEDFLDKSASGTGLAFIIFTEAILHMPGAPGWAVLFFGMLFTLGLSSMFG
NMESIITPLLDMGLTHRSIPKEVLTGLACLLCFLSAICFTLQSGNYWLEVFDNYAAPLNL
IIFAFLEVIGVAYVYGLQRFSDDIVCMTGRRPSLYWRVTWKVVSPLLLLTIFVAYIAVLV
WTPLSYRAWNTQYARFPSRQEKSYPGWVQATCVLLCFLPALWVPGVALVQLLAKHRRKQK
DTWQDRRPKLQDGGAS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcactgtggggccggagcccctgggtgacggtggcgggtccgagaggcccaag
tgggacaacaagctgcagtaccttctgagctgcatcgggtttgccgtgggcctgggcaac
atctggaggttcccgtacctctgccagacctacgggggaggggccttcctcatcccctac
ctcatcgccctggtcttcgagggaatcccgctcttctacgtcgagctggccatcggccag
cgcctgcggagaggcagcatcggggtgtggacggccatctcgccctacctgggtggagtg
gggctgggctgtgtcaccgtgtccttcctggtcagcttgtactacaacactgtcctgacg
tgggtgctgtggtatttcctcaactctttccagtccccgctcccctggagctcctgtcca
ctggacgtcaaccgcacagggtttgaggccgagtgccaggccagcagtaccgtgagctac
ttctggtaccggcagacgctgaacatcacagctgacattagcgacagcggctccatccag
gggcggctgctggcctgcttagccgcatcctgggcagttgtgtacctgtgtgtcatcaga
ggcattgaatccacggggaaggcaatttatttcacagccctgttcccgtacctggtcctg
acaattttccttatcagaggactcaccctgcccggggcggtcgaagggttaatctacttg
ttcacgccagatgtgcagattctccagaacccccgagtgtggctggacgcagccacgcag
atattcttctcactgtccctggccttcggaggacacattgcttttgcaagttataaccca
cccaggaacaactgtgagaaggacgcagtgaccatcgccctggtcaacagcatgacctcc
ctctatgcctccatcgctgtgttctccgtcttgggattcaaggcagccaacgaccatggg
cgttgcctggacagaaacatcctccacctcatcaatgcgttcgatttccccgaccagagc
atctccagggatgactacgcagccgtcctcacgcacctgaatgcctcccagcccgagagg
gtggccaggctccatctggaggcttgccacctggaagactttctggataagagcgcctca
ggcacgggcctggccttcatcatcttcacggaggccatcctccacatgccgggggccccc
gggtgggccgtgctgttcttcgggatgctgttcaccttgggcctgtcctcaatgtttggg
aacatggagagcatcattacgccactcctggacatggggcttacgcacagatccatcccc
aaggaggtcctgacggggctggcctgcctgctatgcttcctctcggcgatctgcttcacg
ctgcagtcgggaaactactggctcgaggtgtttgacaactacgccgcccctctcaacctc
atcatctttgccttccttgaggtgatcggggtcgcttatgtttacgggctgcaacggttc
agtgacgacatagtgtgcatgaccgggagacgacctagcctctactggcgggtgacgtgg
aaggttgtcagcccactgctgttgctgaccattttcgtggcctacattgccgttctggtc
tggacgccgctgagctacagggcctggaacacccaatacgcacggttcccctcacggcag
gagaagtcctacccaggctgggtgcaggccacctgcgtcctcctgtgcttcttgcctgca
ttgtgggttccaggtgttgcccttgtccagctgctcgccaagcacagacggaagcagaag
gacacctggcaggacaggcgcccaaagctgcaggatggaggggcctcctga

DBGET integrated database retrieval system