KEGG   Canis familiaris (dog): 478753Help
Entry
478753            CDS       T01007                                 

Gene name
GALNT13
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 13 isoform X2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00512  Mucin type O-glycan biosynthesis
cfa00514  Other types of O-glycan biosynthesis
cfa01100  Metabolic pathways
Module
cfa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    478753 (GALNT13)
   00514 Other types of O-glycan biosynthesis
    478753 (GALNT13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    478753 (GALNT13)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     478753 (GALNT13)
Glycosyltransferases [BR:cfa01003]
 O-Glycan biosynthesis
  Mucin-type
   478753 (GALNT13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 478753
NCBI-ProteinID: XP_005640243
Ensembl: ENSCAFG00000009140
VGNC: 41088
UniProt: J9NYT5
Position
36
AA seq 556 aa AA seqDB search
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYADELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPRYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDL
CLDVSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCS
GSRSQQWLLRNMTLGA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggtttgtttactgcaaggtggttctagccacttcactgatgtgggttcttgtt
gacgtcttcttactcctgtacttcagtgaatgtaacaaatgtgatgacaagaaggagaga
tccctgttacctgcactcagggctgttatttcaagaaatcaagaagggccaggagaaatg
ggaaaggctgtgctgattcctaaggatgaccaggagaaaatgaaagaactgtttaaaatc
aatcagtttaaccttatggccagtgatttgattgcccttaacagaagtctaccggatgta
agattagaaggatgcaagacaaaggtctacgctgatgaacttccaaacacaagcgtagtc
attgtgtttcacaatgaagcttggagcactctccttagaactgtttatagtgttataaat
cgttccccacgttatctgctctctgaagtcatcttggtagatgatgctagtgaaagagat
tttctcaagttgacattagagaattatgtgaaaaatttagaggtgccggtaaaaattatt
agaatggaagagcgttctgggttaatacgtgcccgccttcgaggagcagctgcttcaaaa
gggcaggtcataacttttctcgatgcacactgtgaatgcaccttaggatggctggagcct
ttgctggcaagaataaaagaagacaggaaaacagtggtatgccctatcattgatgtaatt
agtgatgatacctttgaatatatggctgggtcagacatgacttatgggggttttaactgg
aaactgaatttccgttggtatcctgttccccaaagagaaatggatagaaggaaaggagat
agaacattacctgtaaggacccctactatggctggtggcctattttctattgacagaaac
tactttgaagagataggaacttacgatgcaggaatggatatctggggtggagagaatctt
gaaatgtcttttaggatttggcaatgtggaggttctctggagattgtgacttgctcccac
gttggtcacgtttttcggaaggcaactccatacactttccctggtggcactggtcatgtc
atcaacaaaaacaacaggagactagcagaagtttggatggatgaatttaaagatttcttc
tatatcatatccccaggtgttgtcaaagtggattatggagatgtgtcagtcagaaaaaca
ctaagagaaaatctgaagtgtaagcccttttcttggtaccttgaaaacatctatccagac
tcccagatcccaagacgttattactcacttggtgagataagaaatgttgaaaccaaccaa
tgtttagacaacatgggccgcaaagaaaatgaaaaagtgggtatattcaactgccatggt
atgggaggaaatcaggtattttcttacaccgctgacaaagaaatccgaactgacgacttg
tgcttggatgtgtctagactcagtggacctgtaatcatgttaaaatgccaccacatgaga
ggaaatcagttatgggaatatgatgctgagagactcaccttgagacatgttaacagtaac
caatgcctcgatgaaccttctgaagaagacaaaatggtgcctaccatgcaggactgtagt
ggaagcagatcccaacagtggctgctaaggaacatgaccttgggggcgtga

DBGET integrated database retrieval system