KEGG   Canis lupus familiaris (dog): 478781
Entry
478781            CDS       T01007                                 
Symbol
LRP2
Name
(RefSeq) low-density lipoprotein receptor-related protein 2 isoform X2
  KO
K06233  low density lipoprotein-related protein 2
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04340  Hedgehog signaling pathway
cfa04918  Thyroid hormone synthesis
cfa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    478781 (LRP2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    478781 (LRP2)
  09154 Digestive system
   04979 Cholesterol metabolism
    478781 (LRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    478781 (LRP2)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    478781 (LRP2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF EGF_CA
Other DBs
NCBI-GeneID: 478781
NCBI-ProteinID: XP_038319390
Ensembl: ENSCAFG00000012128
VGNC: 42775
Position
36:complement(13921313..14118067)
AA seq 4722 aa
MRARARVCVRPRNVRAGTPAGVREGLAGGVTEPAEAQASGSARGQRRGGCGCGCGGLRAP
TSRGRNGEAGPGRRGDGARGAGRGVHAAAGPSRLPGAGPRGQECGSEDFRCEDGQCISAS
WRCDGTRDCLDDTDEIGCPPPSCKVNQFLCHGEGQCIPNSWECDGERDCEDGSDEHQHCP
GRTCSSQQITCSDGECIPNEYRCDRVRDCSDGTDEKDCHYPTCEQLTCANGACYNSSQKC
DGKVDCRDFSDENNCTKVCSHHEFQCDSGVCIPRAYVCDHYLDCEDGSDELSCTYETCRG
NQFTCASGYCISQNMVCDGENDCQDNGDENGCESSTHRIHECYPGEWACPESGKCIPIAN
VCDGTLDCPEGEDENNSTKGRYCDVNLCSVLSCEYQCHMSPSGGMCYCPPGFIVDQNNTH
NCVDFNDCQIWGVCDQMCEDRIGHHQCRCAEGYVLEHQRHCKANTSSEQASVIFSNGRDL
LIGDIHGRTFSILVESQNHGVAVGVDFHYHLQRVFWTDTVQDKVFSVDISGFNIQEVISL
DDPENLAVDWINNKLYLVETKVNRIDMVNLDGSHRIILITGNLGHPRGIAVDPTVGYLFF
SDWESLSGEPKLERAFMDGTNRKDLVKTKLGWPAGITLDIVSKRVYWVDCRFDYIETVTY
DGIQRKTVIHGGSLIPHPFGISLFEDRVFFTDWTKMAVMKANKFTETNPQEYHQTSLRPF
GVTVYHSLRQPYVSNPCRDNNGGCEHVCVLSHRTDNDGLGYRCRCTLGFSLDVDNRHCVA
VKQFLIFSSEVAVRGIPFNLSTQEDVIVPVTGNPSFFVGIDFDAKENTIFFSDTSKDMIF
KQNINGTGREILTANRVESVESLTFDWISKNLYWTDASYRSISVMRLADKSRRAIIQNLN
NPRSIVVHPIAGYIFFTDWFRPAKIMRAWSDGSNLLPIVNTTLGWPNGLAIDWGALRLYW
IDAFFDKIEHSTFDGLDRRNLGHIQQMTHPFGLTVFEDHVFFTDWRLGAIVRVRKTDGGD
MRVIRSGITNIMHVKSYDANTQIGSNYCNRPTHPNGDCSHFCFPVPNFQRVCGCPYGMNL
TSNHLTCQEDPSHEPPMEQCGSLSFPCSNGRCVPSNYRCDGVDDCHDNSDEHLCGKMNNT
CAPSAFTCGHGECIPAHWKCDKQSDCVDGSDEQNCPSQAPTSCPASFFTCDNHLCIPRSW
LCDTDNDCADGSDEKNCQFTETCLPSQFRCPDHRCIDLSFVCDGDKDCVDGSDEAGCVIN
CTASQFKCASEDRCISSIYHCDGVFDCSDQSDEIDCSTRPPGMCHPDEFQCQADGVCIPK
SWECDGHQDCILGSDEHHGCAPRTCPPSHFLCDNGNCIYRDWLCDGDNDCRDMSDEKDCP
TQAFHCPSWQWLCPGYSICVNLSAVCDGISDCPNGTDESPLCNQDSCSDSNGGCTHQCVQ
GPFGAQCLCPSGYLLANDSKTCEDIDECDVPGFCSQHCYNMRGSFRCWCDKEYTLDADRR
TCKVTASESLLLLVASQNQIVADNITSQVHNIYSVVRNGSHIVALDFDSISGRVFWSDGS
QGKIWSAFQNGTDRRVILNSGVTMTESIVVDWVGRNLYWTDYALETIEVSKLDGSHRTVL
ISKNISNPRGLALDPRISDHLMFWSDWGHHPRIERASMDGSLRTVIVQDKIFWPSGITID
YPNRLLYFLDSYLDYIDYCDYDGQHRRQVIASDLILRHPYALTLFEDSVYWTDRSTYQVV
QANKWHGGNQSVIIRNVPQPLGVVAVHPVKQPDGENSCASSSCSHLCLLSSQRPHLYSCA
CPSGWSLSHDSVTCLKDDQPFLITVRHSIIFGISLNPEVKSNDAMVPIAGVMNGYDVEFD
DSEQFIYWVENPGEIHRVKTDGTNRTVLVSLSRLGSSMSLALDWISRNFYYTNPGTPSIE
VLKLQGDVRYRKTLITNDGTALGVGSPVGITVDPVNGKLYWSDQGTDSGVPAKIASANMD
GTFPKVLFTGNLEHLEFITLDIKEQKLYWAVTSTGVIERGNVDGTNRMILVNHLSHPWGI
AVYDSFLYYTDEHYEVIERVDKATGDNKVVLRENIPNLRGLRVYHRHDASSNGCSNNVNA
CQQLCLPIPGGLFSCACASGMKLNPDNRTCSPYSSFLVVSMLSIIRGFSLEFSDHSEAMV
PVAGQGRNALHVDVDVSSGFIYWCDFSSSMTSRNAIRRIKPNGSGFTNIVTHGIGENGVR
GIAVDWVAGNLYFTNAFVSETLIEVLRINTTYRRILLKATADRPRDIVVDPKNRYLFWAD
YGQSPKIERSFLDCTNRTVLVSEGIVTPRGLAVDHSNGYIYWVDDSLDIIARIGIEAEET
EVIRYGSRYPTPYAITVFGNSIIWVDRNLKKIFQASKEPNSSEPPTVIRDNLNWLRDVTI
FDQSVQPRSPAEVNNNPCLENNGGCTHFCFALPGLDTAKCGCAFGTLEGNGKSCAMPSEN
FLIFALENTLRSLHLDPEVHSPPFQAISVDRVAVDLAYDGLSNRIYFTQSLESGNSRISY
VSLNSGTRSPTAVISGKGNLDGIAFDWINRRIYYSDYTNQTINSMAEDGSQRTVIAHVSK
PRAIVLDPCRGYMYWTDWGTNAKIERATLGGNFRVPIVNSSLVWPNGLTLDYENDLLYWA
DASLQKIERSTLTGTQREVIVNTAFHPFSLTLYGQYIYWTDWNTKRIYRANKYDGSGQTA
MTTSFPFRPNGIRVVVKNQQQQCSNPCSEFNGGCSHICAPGPNGAECQCPHEGHWYLANN
KKHCIVDNGTRCDSSKFTCLNGHCILEQWKCDNDNDCGDGSDELESVCAFHTCQPTAFTC
ANGRCVQYHYRCDHYNDCGDNSDEAGCLFRECNATVEFTCSNRRCIPLQFVCNGINNCHD
NDTSDEKNCSDRTCQPGYVKCQTTNICIPHFYLCDEDNDCGDMSDESPVFCASHTCSSDE
FPCTSGRCIPKHWYCDEEGDCPDGSDEPATCEYLEATCLSSEFKCDSGRCIREEWICDGD
NDCGDMSDEDERHHCESHNCSSSEFLCANNVPPSRKCIPKSWVCDGDADCTDGYDEHQNC
TRRSCSGNDFTCSNGLCVPHSYRCDRRNDCGDYSDERNCSYSTCSENQFTCQNGLCIYKQ
DVCDGENDCRDGSDELEHLCHTPETTCPPHQFKCDNGNCIDMAKVCNHLDDCSDNSDEKG
CGVNECNDPLLSSCDQNCTDTLTSFYCSCRPGYKLMSDKRSCDDIDECKETPFVCSQMCE
NVMGSYICKCAPGYIREPDGKSCRQNSNIEPYLIFSNRYYLRNLTTDGHYYSLILQGLGN
AVALDFDRVEKRLYWIDAENKVIERMFLNKTNRETVINHKLPAAESLAVDWVARKLYWLD
AYLHCLSVSDLDGRYRRKLAEHCVDVNNTFCFDHPRGIALHPRYGYVYWADWAYQAYIGR
IGMDGTNKSVIISTKIEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGRHRHTVYDRTLP
HPFAITIFEDTIYWTDWNTRTVEKGNKYDGSDRIILVNTTHKPFDIHVYHPYRQPFVNNP
CGTNNGGCSHLCLIKAGGNGFTCECPDDFHTLRMGDMNICLPRCSSTQFLCANSEKCIPI
WWKCDGQRDCSDGSDEPVLCPQRYCRLGQFQCKDGNCTSSHFLCNAHQDCPDGSDEDQIL
CEHHRCESNEWQCANKRCIPEAWRCDSENDCGDNSDEDVYNCASRICQPGYFKCANNHCI
PQDWKCDVDNDCGDYSDEPMPECMSHRCDNHTEFSCRTNYRCIPQWSVCNGFDDCRDNSD
EQGCEERTCKPSGEFRCNNHRCIPLRWRCDGHNDCGDHSDEENCVPRECSESEFRCDDQS
CIPSRWVCDHTNDCGDNSDERDCEMKTCQPGYFQCQSGHCVSEQVKCDGTADCLDASDEA
TCPTRFPNGAYCSATMFECKNHVCVRSSWKCDGDDDCGDGSDEELHLCLDVSCESPNRFR
CDNNRCIYKHELCNHVDDCGDGSDEKEEQCLASTSRPCTENEFKCSNGHCISQNLVCDDV
DDCGDHFDETGCNTGKERSCAENLCEQNCTQLNEGGFICSCRPGFKASILDRNSCDDINE
CEQFGVCPQNCQNTKGSYECSCAEGFRSVSDQYGKRCAADGNPPLLLLPENVRIRKYNLS
SEKFSDYLEGEERIQAIDYDWDPEDIGLSVVYYTVLGHGSDFGAIKRAYIPNFESGTNNL
VSKVNLNLKYIMQPDGLAVDWVGRHIYWSDAKSKRIQVAKLDGRYRKWLISTGLDQPAAV
VVNPKLGLMYWTDWGREPKIESAWMDGQHRKTLVQENLGWPTGLAIDYLNNDRIYWSDFK
ENNIETIKHDGTDRRIVANAAMNPYSLDIFEGQFYWISKDKGEVWKQDKFGQDEKEKMLM
VNPWLTQVRIFHQHRYDRSVPNRCKNVCSHLCLLRPGGYSCACPQGSTFIEGSITDCNAA
IESPINMPPPCRCMYGGNCYFDENDLPKCKCPSGYMGKYCEIGLSKGVPPGTTVAVLLTI
ILIIIVGALAALGFFHYRRTGSLLPSLPKLPSLSSLVKSSENGNGVTFRSGADVNMDIGV
SGFGPESAIDRSMVMSENFAMEMGKQPIIFENPMYASRDSDIKVVQPTQVTASGNVDNQN
YGSPINPSEIAPDTKPTSPSADGTQATKWNIFKRKLKPTTNFENPIYAEMENEQKDSTAV
APPPMPSVLAKSSPKRDPVPTYTATEDTFTDTANLVREDSEV
NT seq 14169 nt   +upstreamnt  +downstreamnt
atgcgcgcacgcgcgcgcgtgtgtgtgcggcctcggaatgtgcgtgccggcacgccagcg
ggcgtgcgagagggactggcaggtggcgtgaccgagccggccgaggcgcaggcctccggg
agcgctcgcgggcagaggcgcggcggctgcggctgcggctgcggcgggctccgcgcgccc
acctcccggggaaggaacggcgaggccgggcccggacggcgcggggatggagcgcggggc
gcgggccgtggcgtgcacgctgctgctggccctagccgcctgcctggcgccgggccccgt
ggccaagaatgtggaagtgaggattttcgctgtgaagatgggcaatgtatctctgcatcc
tggaggtgtgatgggaccagagactgcttggatgacacagatgaaatcggctgccctcct
ccttcttgcaaggtgaaccaattcctgtgtcatggtgaaggtcaatgcatccctaactcc
tgggaatgtgatggtgaacgggactgtgaggatggctctgatgaacatcagcattgtcct
gggagaacatgctcaagccaacagattacatgctctgatggtgaatgtataccaaacgaa
tacaggtgtgaccgcgtcagagactgctcagatggaactgatgagaaagactgccactac
ccaacgtgtgaacagcttacttgtgccaatggagcctgctataacagcagtcagaaatgt
gatgggaaagttgactgcagagacttctctgatgaaaacaattgcactaaggtctgttca
caccacgagttccagtgtgacagcggggtgtgcatccctcgtgcctacgtctgcgaccat
tacctcgattgcgaagacggcagtgatgaactttcttgcacctatgagacctgcagaggc
aaccagttcacttgtgccagcggctactgcattagtcaaaatatggtctgtgatggagag
aatgactgtcaagataatggagatgaaaatggatgtgaaagcagtacacaccgtattcat
gaatgttacccaggtgaatgggcttgtccagagtctggaaaatgcatcccaattgcaaat
gtttgtgatgggactttagattgtccagaaggagaagacgaaaacaatagcaccaaaggg
cgatattgtgatgtgaatttgtgttctgtattgagctgtgagtaccagtgccacatgtca
cccagtggagggatgtgttattgtccaccaggttttatcgttgaccaaaataatacccac
aactgtgtcgattttaatgattgccagatatggggagtttgtgatcagatgtgtgaagac
cgaattggccaccatcagtgccgctgtgcggaaggatatgtcttggagcatcagcggcat
tgtaaagctaatacttcctctgagcaagcctccgttatcttctccaatggtcgggatttg
ctaattggtgatattcatggaaggaccttttcgatactggtagagtctcaaaatcatgga
gtggctgtgggtgtggattttcactatcacctacagagagtcttttggactgacaccgtg
caagataaggttttttcagttgacattagtggtttcaacatccaagaagtcatttctctt
gatgatccagagaatctagctgtggactggattaacaataaactttatttggtagagacc
aaggtcaaccgcatagatatggtaaatttggatggaagccatcggattatccttataact
ggaaacttggggcatcctagaggaattgctgtggacccaactgttggttatttatttttc
tcagattgggagagcctttctggggaaccgaagctggaaagggctttcatggatggcacc
aaccgtaaagacttggtaaaaacaaaactgggatggcctgctgggataactctggatata
gtatcaaagcgtgtttactgggttgactgccgttttgattacattgagactgtaacttac
gatggaattcaaaggaagacagtaatccatggaggctcactcattcctcatccctttgga
ataagcttgtttgaagatcgtgtattctttactgattggacaaagatggctgtaatgaag
gcaaacaagttcacagagaccaatccacaagagtaccaccagacttctctgaggcccttt
ggagtgactgtttaccattccctcaggcagccctatgttagcaatccatgcagagataac
aatgggggctgtgaacatgtctgtgtcctcagccacaggacagataatgatggtttgggt
taccgctgcaggtgcacactcggcttcagcctggatgtggataaccgccactgcgttgct
gttaagcaattcctgatcttttcatctgaagtcgctgttcgtggcatcccattcaacctg
tctacccaggaagatgtcatagttccagtgacaggaaatccttctttctttgttgggatt
gattttgatgcgaaggagaacactatctttttttcagatacatcaaaagacatgatcttt
aaacaaaatatcaatggcacaggaagagaaattctcactgccaacagggtggaaagtgtt
gaaagtctgactttcgactggatttcaaagaatctttattggacagatgcttcttaccgg
agtatcagtgtcatgaggctagctgataaatcaagacgtgcaataatccagaatttaaat
aacccccgatcaattgtagttcatcctattgctgggtacatattcttcactgattggttc
cgtcctgctaaaattatgagagcgtggagtgatgggtctaaccttttgcctatagtaaac
actactcttgggtggcccaatgggttggccattgattggggggctttacggttgtactgg
atagatgccttttttgataaaattgagcacagcacctttgatggtttagacagaagaaac
ctgggccatatacaacagatgacacatccatttggacttactgtctttgaagaccatgtg
ttttttactgactggagactgggtgctattgttcgagtcaggaaaacggatggtggagac
atgagggttattcgaagtggtatcactaatataatgcatgttaagtcatatgatgccaac
actcagattggttctaactactgtaatcgacccacacatccaaacggtgactgcagccac
ttttgcttcccagtgccaaatttccagcgtgtgtgtggttgcccctatggaatgaatttg
acttctaatcacttgacatgccaggaagacccatcccatgaaccacccatggagcagtgt
ggctccctttcttttccttgtagcaacggcagatgtgtgccaagtaactaccgctgtgat
ggagtagatgactgtcatgataacagtgatgagcacctatgtggcaaaatgaataatacc
tgtgcaccttcagcgttcacctgtggccacggagagtgcatccctgcacactggaaatgt
gacaagcagtctgactgtgtggatggcagcgatgagcagaactgtccctcccaagcaccc
acttcctgccctgcatccttcttcacctgtgataatcatctgtgtatcccaaggagctgg
ctctgcgacacagataatgattgtgcggatggatctgatgaaaagaactgccaatttaca
gagacatgcctacctagtcaatttcgttgtcctgatcatcgatgtattgacctatctttt
gtctgtgatggggacaaggactgtgttgatggatctgatgaagctggttgtgtaattaat
tgcactgcttctcaattcaaatgtgccagtgaggatcggtgtattagtagcatatatcat
tgtgatggtgtttttgactgcagtgatcaatctgatgagatagactgttcaactaggcct
cctggtatgtgccacccagatgaatttcagtgccaagcagatggtgtttgcatcccgaag
agctgggagtgtgatgggcaccaagactgcatcttgggatctgatgagcatcatggctgt
gcccctaggacctgccctccatctcacttcctatgtgacaatggaaactgcatctacaga
gattggctctgtgatggggacaatgactgcagggatatgagtgatgagaaggactgccct
actcaggcctttcactgtcccagttggcaatggctttgccccggctatagcatctgtgtg
aatctgagtgcagtgtgtgatggcatctctgactgccccaatgggacagatgaatcccca
ctttgcaaccaggatagctgctcagattccaatggtggttgtactcaccagtgtgttcag
gggccctttggagctcaatgcctgtgtccatcaggatacctccttgccaatgattctaag
acctgtgaagacatagatgaatgtgatgttccaggcttttgtagccagcattgttataat
atgagaggttctttccggtgctggtgtgataaagaatacacgttagatgctgacagaagg
acttgcaaagttacagcatctgaaagtcttttgctacttgtggcaagtcagaaccagatc
gttgctgacaatatcacctcccaggttcacaatatctattcagttgtccggaatggttct
cacattgtagctcttgattttgattcaatcagtggtcgtgtcttttggtctgatggaagt
cagggtaaaatctggagtgcttttcaaaatggaacagacagaagagtcatacttaacagt
ggtgtcactatgacggaaagtattgtggtagattgggtaggtcgcaatctttactggaca
gactatgcactggaaacaatcgaagtatcaaaactggatggtagccacaggactgtgctg
attagtaagaatatatcaaatccaaggggtctagcattagaccccagaattagtgaccat
ttgatgttctggtctgactggggccatcaccctcgtattgagagagccagcatggatggc
agtctgcgcactgttattgttcaggacaagattttctggcccagtggcattactattgac
taccccaacagactgctctacttcttagattcctatcttgattacatagactattgtgat
tatgatggacagcatcggagacaagtgatagccagtgatttgattctgcgacatccctat
gccctaactctctttgaagattctgtgtactggacagaccgctctacttatcaggttgtt
caagccaataagtggcatggtgggaaccagtcagtcataattcgtaatgttcctcagccc
cttggggttgttgcagttcatcctgtgaaacaaccagatggtgaaaattcatgtgcttct
tcctcctgcagccatctatgcttactttcctcacagaggccacacctttattcctgtgct
tgtccttcgggatggagtctttctcatgattctgtgacttgcttgaaagatgatcaacct
ttcttaataaccgtaagacacagtataatttttggaatctcccttaatcctgaggtgaag
agcaacgatgctatggtccccatagcaggggtgatgaacggttatgatgttgaatttgat
gactcggagcagttcatctattgggttgagaatccaggtgaaattcacagagtaaagaca
gatggcaccaacaggacagtattagtttctctatcgaggttggggtcttccatgagcctg
gccttagattggatatcaagaaacttttattacaccaatcctggaactccatcaattgag
gtcttgaaactccagggagatgtcagatacagaaaaacactgattaccaatgatgggaca
gctcttggagttggtagtccagttggcataactgttgatcctgttaatgggaaactatac
tggtcggaccaaggaacagacagtggtgttcctgccaagattgcaagtgctaacatggat
ggcacattcccaaaagttctcttcactgggaaccttgaacacctggagtttatcaccctt
gatatcaaggagcagaaactctactgggctgtcaccagcacaggagtgattgaaagagga
aacgtggatggtacaaatcgaatgattctggtaaaccatctttcccacccctggggaatt
gctgtctatgattccttcctttattatactgatgaacactatgaggtcattgaaagagtt
gacaaggccactggggacaacaaagtagtcttgagagagaatattccaaatttgaggggt
cttcgagtttatcacagacatgatgcatcctccaatggctgtagcaacaatgtgaatgcc
tgtcagcagctttgcctgcctataccaggaggcttattctcatgtgcctgtgccagtgga
atgaaactgaatcctgataatcggacctgttctccatatagctcttttcttgttgtttca
atgctctccataatcagaggctttagcttggaattttcagatcactcagaagccatggtg
ccagtggcgggccaaggacgaaatgcgctgcatgtggatgttgatgtatcttctggcttt
atttattggtgtgattttagcagttctatgacatctcgtaatgcaatccgtagaatcaaa
cccaacgggtctggttttacaaacattgttacacatgggataggagaaaatggagttcgg
ggtattgcagtggattgggtagcaggaaatctttatttcaccaatgctttcgtgtctgaa
acactgatagaagttctgcggatcaataccacttaccgtcgtattctccttaaagccaca
gcagataggcccagggatattgttgtagaccccaagaacaggtatctcttctgggctgac
tatgggcaaagcccaaagattgaacgttcttttcttgattgtaccaatcgaactgtgctt
gtatcagaaggcattgtcacaccacggggcttggcagtagaccatagcaatggctacatt
tactgggttgatgattctttagatataattgcaaggattggtattgaggcagaggaaact
gaagtgattcgttatggcagtcgttacccaactccttatgccatcactgtttttggaaat
tctatcatatgggtagacaggaatttaaaaaaaatcttccaagctagcaaggaaccaaat
agcagtgagccaccaacagtgataagggacaatctcaattggctaagagatgtgaccatc
ttcgaccagagtgttcagccccgatcaccagctgaggtcaacaacaacccttgcttggaa
aataatggtggatgcacccatttctgctttgctctgcctggattggacactgcaaaatgt
ggctgtgcttttggaactctagaaggtaatggcaagagctgtgccatgccatcagaaaat
ttcctcatctttgccttggaaaacaccttgagaagcttacatttggaccctgaggttcat
agcccacctttccaagcaataagtgtggatagagttgctgtagacctagcctatgatggc
ctaagtaacagaatctacttcacacaatcgttagaatctggaaacagtcggatttcatac
gtcagtctaaattcagggaccagatcacccactgctgttatttcaggtaaagggaatctt
gatggcattgcctttgactggatcaatagaagaatatattacagtgactacaccaaccag
acaattaactccatggcggaggacgggtctcagcgcactgtgatagcccacgtttcaaaa
ccaagagcaattgtattggatccttgccgagggtacatgtactggactgactggggtact
aatgccaaaattgagagagccacactgggaggaaatttccgggtacctattgtgaacagc
agcctggtatggcccaatgggctcactctggactacgaaaatgatcttctttactgggca
gatgccagtctgcagaagattgaacgtagcactctaacaggcacgcagcgtgaggtcatt
gtcaacacagcctttcatccttttagcttgactctctatggccagtatatttattggact
gactggaacacaaaaagaatttaccgagctaacaaatatgatgggtcaggtcagacggca
atgaccacgagttttcccttccggcctaatggtattcgtgttgtcgtgaagaaccaacag
cagcaatgtagcaatccttgcagcgagtttaatgggggctgcagtcatatttgtgcacca
ggtccaaatggtgctgagtgccaatgtccacatgagggccactggtatctggccaacaac
aaaaaacactgcattgtggacaatggtacacgatgtgatagttccaagttcacctgcctc
aatgggcactgcatcttggagcaatggaaatgcgacaacgataatgactgtggtgatggc
agtgatgagctggaaagcgtctgtgcatttcatacgtgccagccgacagccttcacctgc
gccaatgggcgatgcgtccagtatcattaccgttgtgaccactacaatgactgtggtgac
aatagtgatgaggcagggtgcctgttcagggaatgtaatgccactgtggagtttacttgc
agtaacagaaggtgcattcctcttcagtttgtctgcaacggcattaacaactgccatgat
aatgatacctcagatgagaaaaattgctctgatcgcacctgccagcctggatatgtaaaa
tgtcagacgaccaacatttgcattcctcatttttacttgtgtgatgaagataatgactgt
ggagacatgagtgatgaaagccctgttttctgtgcttctcacacgtgcagcagtgatgag
tttccctgtacgtctggacgttgtatccctaaacactggtactgtgatgaagagggagat
tgtcctgatggctctgatgaacctgccacttgtgagtaccttgaagcaacatgcttaagt
agtgagttcaagtgtgacagtgggaggtgcattcgagaggaatggatctgtgatggggat
aatgactgtggggacatgagtgatgaagatgaaagacaccactgtgagagtcacaactgc
tcaagttctgagtttctctgtgcaaacaatgtgcctccatccaggaagtgcattcctaaa
tcctgggtctgtgatggcgatgcggattgtaccgatggctatgatgagcatcagaattgc
acaaggagatcttgctctggaaatgatttcacctgtagtaatggattgtgtgtcccacac
tcatacaggtgtgaccggcgcaatgactgtggggactacagtgatgagaggaactgctcc
tactccacctgcagtgagaaccagtttacctgtcagaatgggctgtgcatttataagcag
gatgtctgtgatggggaaaatgactgtagagatgggtctgatgagctggagcacctatgc
cacactccagaaaccacatgcccccctcatcagttcaagtgtgacaatgggaactgcatt
gatatggcaaaagtctgcaaccacctagatgactgttcagacaacagtgatgagaaagga
tgtggtgttaatgagtgcaatgaccctttgctcagcagctgtgaccaaaactgcacagac
accctcaccagtttttattgttcttgtcgtcctggttacaagcttatgtctgacaaacgg
agttgtgatgatattgatgaatgcaaggagacgccctttgtctgtagtcagatgtgtgag
aatgtaatgggctcctacatctgtaagtgtgccccaggctacatccgagaaccagatgga
aagagctgccggcagaacagtaacatcgaaccctatctcatttttagcaaccgttattat
ttgaggaatctaactacagatggccattattactccctcattttacaaggactgggcaat
gctgtggctctggattttgaccgagtagaaaagagattgtattggattgatgcagagaat
aaagtcattgagagaatgtttctgaataagacaaacagggagacagtcattaaccacaaa
ctaccagcagcagaaagtttggctgtagattgggttgccagaaagctctattggttggat
gcctacctgcattgcctctctgtctctgaccttgatggtcgataccgccgcaagttggct
gagcactgtgtggatgtcaacaatactttctgctttgatcatcccagaggaattgccctt
caccctcgatatgggtatgtctactgggcagactgggcttaccaagcatacattggaaga
ataggcatggatggaacaaataagtctgtgattatctctaccaagattgagtggcccaat
ggcatcaccattgattacaccaatgatctactctactgggcagatgcccacctgggttac
attgagtactctgatttggagggccgccatcggcacacggtatacgacagaacactgcct
cacccctttgctattaccatttttgaagacactatttattggacagattggaatacaagg
acagttgaaaagggaaacaaatatgatggatcagataggattatactggtgaacacaaca
cataaaccatttgacatccatgtgtatcatccatacaggcagccatttgtgaacaacccc
tgtggtaccaacaatggtggctgttcgcacctctgcctcatcaaagcaggaggaaatgga
ttcacctgtgagtgtccagatgacttccataccctccgtatgggtgacatgaacatctgc
ctgcccaggtgctccagcacccaattcctgtgtgccaacagtgaaaagtgtattcctatt
tggtggaaatgtgatggacagagagactgctcggatggctctgatgaaccagttctttgc
ccacagcgctactgccgattaggccaattccaatgcaaggatggcaactgcaccagctca
cacttcctgtgcaatgctcaccaagattgccctgatgggtctgatgaagaccagattctt
tgtgagcatcaccgctgcgagtccaatgaatggcagtgtgccaacaaacgttgcatccct
gaagcctggcggtgtgactcggagaacgattgtggtgataactcagacgaagatgtttac
aactgtgccagcaggatctgccagccgggctattttaagtgtgccaataaccactgcatc
cctcaggactggaagtgtgatgtggacaatgactgtggagactactcggatgagcccatg
cccgaatgcatgagccaccgctgtgacaaccatacagaattcagctgtaggacgaactac
cgctgtatcccacagtggtctgtgtgcaatggttttgatgactgcagggacaacagtgat
gagcaaggctgtgaggagagaacgtgcaaaccttcaggggaatttcgctgtaataatcac
cgctgcatccctcttcgctggaggtgtgatgggcacaacgactgtggagatcactcagat
gaagaaaactgtgtcccccgggagtgctcagaaagtgagtttcgatgtgatgatcaaagc
tgcattccctctcgatgggtctgtgaccataccaatgactgcggcgacaactcagatgag
cgggactgtgagatgaagacctgccaacctggatattttcagtgtcagagtggacactgt
gtgtctgagcaagtgaaatgtgatggaactgctgactgtctggatgcctccgatgaagcc
acctgtcccactcgcttccccaatggtgcatattgctcagctactatgttcgaatgtaaa
aatcacgtttgtgtcaggtcatcttggaaatgtgatggtgacgatgactgtggcgacggt
tctgatgaagaacttcacctgtgcttggatgtgtcctgtgagtctccaaaccggttccga
tgtgacaataatcgctgtatttataagcatgagctgtgcaaccatgtggatgactgtgga
gatgggagcgatgagaaagaggagcagtgtttagcttcgacctctagaccttgtacagaa
aatgaatttaagtgtagcaatggacattgcatttcacagaatcttgtatgcgatgatgtc
gatgactgtggtgaccattttgatgaaacgggttgcaatacaggaaaagaaagatcatgt
gcagagaatctatgtgaacaaaattgtacacagttaaatgaaggaggctttatctgttcc
tgtagacctgggttcaaagccagtattttggacagaaactcctgtgacgacatcaatgaa
tgtgagcagtttggggtttgtccccagaactgccagaacaccaaaggaagttatgagtgt
tcctgtgccgaaggcttcaggtctgtgagtgaccagtatggaaaacgatgcgctgctgat
ggtaaccctcctttgttgctactgcccgaaaatgtccggattcgaaaatataatctctca
tctgagaagttctcagattatcttgaaggcgaagaacgtattcaggctattgattatgat
tgggatcctgaagacataggtctcagtgttgtatattatactgtgctagggcatggctct
gattttggtgctatcaaacgtgcctacatccccaactttgaatctggtactaataatctc
gtgtcaaaagttaacctgaacctgaaatacataatgcaaccagatggattagcagtggac
tgggttggaaggcatatttactggtcagatgccaaaagcaaaaggatccaggtggctaaa
cttgatgggaggtacagaaagtggctgatttccactggactggatcaaccagctgcagtg
gttgtgaatcccaaactagggcttatgtactggactgactggggcagagaacctaaaatc
gagtctgcctggatggatggacagcatcggaaaaccctggttcaagagaaccttggttgg
ccaactggccttgccattgattatttgaacaatgaccggatctactggagtgacttcaag
gagaacaatattgaaactataaaacatgatgggactgataggagaattgttgcaaatgca
gcaatgaacccatatagtctggacatctttgaaggccagttttactggatatctaaggat
aagggagaagtatggaagcaagataaatttgggcaagatgagaaagagaaaatgctgatg
gtgaacccatggctcactcaagttcgaatcttccatcaacatagatatgatcgatcagtg
cccaaccgctgtaaaaatgtctgcagtcacctctgcctcctgagacccggaggctacagc
tgtgcctgcccccagggctccacgtttatagaagggagcatcactgattgtaacgcagcc
atcgaaagtcccatcaacatgccccccccatgcaggtgtatgtacggaggaaattgctat
tttgatgagaatgacctccccaaatgcaagtgtcccagtggctacatgggaaaatattgt
gaaatagggctttcaaaaggcgtccctccaggaacaacagtggcagtgctgttgactatc
atcttgatcatcatagttggagctctggcagccttaggatttttccactacaggaggact
ggctcccttttgccctccctgcccaagctaccgagcttaagcagtctagttaaatcctct
gaaaatggaaatggggtgaccttcagatcaggagcagatgttaacatggatattggagta
tctggttttgggcccgagtctgctattgacagatcaatggtgatgagtgaaaactttgcc
atggagatggggaagcagcccataatatttgaaaacccaatgtatgcatccagggacagt
gatatcaaagtggttcagccaacccaggttactgcttctggaaatgtggataaccagaac
tacggaagtcccataaacccttctgaaatagctccagacacaaagccaacttccccaagt
gctgatggaactcaggcaacaaaatggaatatcttcaaacgaaaactgaaaccaaccact
aactttgaaaatccaatctacgcagagatggagaatgaacagaaggatagcactgctgtg
gccccacctccaatgccttctgtccttgctaaaagttctccaaagagagatccagtgcca
acctatactgcaacagaagacacttttacagacaccgcaaaccttgttagagaagactct
gaggtatag

DBGET integrated database retrieval system