KEGG   Canis familiaris (dog): 478820Help
Entry
478820            CDS       T01007                                 

Gene name
TTN
Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa05410  Hypertrophic cardiomyopathy (HCM)
cfa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    478820 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    478820 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    478820 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    478820 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cfa04812]
    478820 (TTN)
   04147 Exosome [BR:cfa04147]
    478820 (TTN)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     478820 (TTN)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   478820 (TTN)
Membrane trafficking [BR:cfa04131]
 Others
  Actin-binding proteins
   Others
    478820 (TTN)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     478820 (TTN)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   478820 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Titin_Z Pkinase fn3_4 C1-set Pkinase_Tyr SusE PPAK Adeno_E3_CR1 Izumo-Ig THB Ig_4
Motif
Other DBs
NCBI-GeneID: 478820
NCBI-ProteinID: XP_022270508
Ensembl: ENSCAFG00000014025
VGNC: 53109
Position
36
AA seq 34553 aa AA seqDB search
MTTQAPTFKQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQAISTSTLPGVQISFSE
GRARLTIPAVTQANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLVIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEDVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
LDGATGQQLPHKTPPRIPPKPKSRSPTPPSAAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISTSPIRSVKSPLLVRKTQAPGVTPGPEVPPPWKQEGFVASSEAEMRE
TTVTSTTQIRTEERWEGRFGVQEQVTVSRAAGAAGAVEVRGLRGRGCGVGAGVGAAGSSV
LGVGWVLRGPGCCKVGAAASVQRGGCCGVLSAAELGPRGEFHGVGTAGSWVLRGGCRGIC
AAQWVPWGGYCANRGSDLGPAPRDPPTRGGRLWRCPRPRAVPRLPGGCEDSASPIRVSQE
AVKSAAVATVVAAVDMARVREPVTSAVEQAAQRTTTTAVHVQPAQEQIKKEAEKKTAVTK
VVVAADKTKEQELKSRTREVITTKQEQVHVTHEQIRKETEKAFVPKVIISAAKAKEQETR
VSGQITTKQEQKQVTQETIIQKAVIAAASVVVAATAEPTKLETMLGAQEEIATHDQMHVT
QEKMMKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVQITHEKMRKEAEKTALS
TIAVATAKAQEQETILRTREGMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREP
REPGPPRESYAQQTTLEYGYKEHISATKVAEHPQRPASEPHVVPKAVKPRVIQAPSETHI
TTTDQMGMHISSQIKKTTDITTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGS
AIATLQKELSAASSAQKITKSVKAPTVKPAEARVRAEATPSPQFPFADTPDTYKSQAGIE
VKKEVGVSITGATVHEERFTVRREHEAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEG
ESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSA
VNEAGTVSTSCYLAVQASEEFEKETTVTEKLTTEEKRFVESRDVVMTDTSITEEQAEPGE
PAAPFFITKPVVQKLVEGGSIVFECQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGE
CRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEAEYESLMKSQQEMLYQTQMTAFVQ
EPKVGEMAPGFLYSDYEKEYEKEQALIRKKMAKDTVMVRTFVEEQEFHISSFEERLIKEI
EYRIIKTTLEELLEEDGEEKMAVDISESEAIEAGFDLRIKNYRILEGMGVTFHCKMSGYP
LPKIAWYKDGKRIKHGERYQMEFLQDGRASLRIPVVLPEDEGIYTAFASNMKGNAICSGK
LYVEPAAPLGAPTYIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPARMSPARMSPARMS
PGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIV
NDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGKSSISVILTVEAVEHQVKPMF
VEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKID
STVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELE
PLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEW
LHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEK
SLVEESQLPEGREGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETA
RFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPE
GVIEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVDTTEAKEVVK
LKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDEL
LHWTKELTEEEKKALMEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFR
VRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTPEDSASIMVKAINIAG
ETSSHAFLLVQAKQSIIFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEVHAGD
KYRMHSDRKVHFLSILTIDTADAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEV
PESFSGELECVISPENIEGKWYHNGVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSF
VVDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQPS
DRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPSLGLSTSGRVSVYSVDVITPLKDVNVLE
GTRAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLM
VGRVETSCDVSVEKIKIIRGLRDLTCTETQNVVLEVELSHSGIDVLWNFKGKEIKPSSKY
KIEAHGKIYKLTVLNMMKDDEGEYTFFAGENMTSGKLTVAGGAISKPLTDQTVAESQEAV
FECEVANPDSEGEWLKDGKHLPLSNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKT
SAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLQSNDKYDISVK
GTVYTLRIKNCAVVDESVYGFKLGKLGASARLHVETVKIIKKPKDVTALENATVAFEVSV
SHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPADAGEYTAVVGQLECKAKLF
VETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQL
IIMNTSTEDAAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFEVTVNYEGIS
YKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTATLYVEARHI
EFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELPSVDRIKIQKEKYVHRLFIPS
TRMSDAGQYAVVAGGNMSTANLYVEGRDVRIRSLKREVQVIEKQRAVVEFEVNEDDVDAH
WYKDGIEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNAPEP
PQILQELQPATVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL
IEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSE
GQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVA
NNAMGQVSSTANLRLAAPESILHGRIEEQIEVEMKEFSSSLLSAEEEGFQTYSSGHQLSN
GNETLELLSAPSIHSTTFESKKEGHVPVFIKEVSNAEISIGDVAKLSVTVTGIPKPKIQW
FFKGVMLTPSADYKFVFDGNDHSLIILFTKFEDEGEYTCVASNEYGQAVCSASLKISSKG
EGQKETEAEPVETFLEKFEGPCPPYFLKEFKPIHCARGLPAVFEYVVLGEPAPTVTWFKE
SKQLCTNVYHTIIHNPDGSGTFIVNDPQREDSGLYVCRAENMWGESTCTAELLVLLEDTD
MTDALCKAKPTPEATKDFPEMSLKGPAVEASDSEQEIAAFVNSTILKAASVAEESQQLSH
EHIVQTSELSSQVTLVAEQLQSTVTLEQNMPDAESTRARLSINGTIHVQPIKEPSPNLQL
QVIQSQKTLPKEDVLMLQEPESQVILSETEKIFPSAMSVEEISSLTVESMKTFLAEPEGS
YPQSSIEEAPAPSYSTSVAEEVLLSKEKTVSAMDKEQSLPPPKQEAQSAPILSQSLAEGN
MESLKGADVIISEVHCEPQVPSEHTCTEDEIVMESADELESAGQDFAARTEEGKSLRFPL
AYEEKQVLLKEEHSDNLAVPLNQTSEYKKEPMVINGVPEVQASDTLSKESLLSGIPEEQR
LNLKTQIRRALQAAVASEQPSLFSEWLRNVEKVEVKAIHFTQEPKRVMCTYLITSVNTLT
EELTIAIEGIDPQMADLTTELKDALCSVICEEINILTAEDPRIQKGATTGLPEEMGPSSE
SQKVEAIWEPEAESKYLVSVEEVSCFHVESQVKVGDTTGVPDGVTPAVSPDEKQAEIPKP
SEEKEKLPGGGAGEGGVGEAQEAEGSAVGEDGPVMLTPLVDTTAEEGDVVNLTSSITNAK
EVNWYFEGKLVHSDEKFKCLQDQNTYTLVIHGVNTEEHQGAYTCEALNAKGNASTSAKLT
VVKRAAPVIKRRIEPLEVALGHLAKFTCEVQIAPNVRFQWFKAGREIYESDKCSIRSSKY
VSTLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFYSRPKSVTTFVGKTAK
FLCTVLGTPVIETIWQKDGAALSPSPNRKISEAENKHSLELSNLTIQDRGVYSCKASNKF
GADICQAELIIIDKPHFIKELEPVQSAINKKIRLECQVDEDRKVTVTWNKDGQKLPPGKD
HKIYFEDKIASLEIPLAKLKDSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLM
LPGESARLHCKLKGSPVIQVTWFKDNKELNESNTIRMSFVNSEAVLDLTDVKVTDSGSYS
CEAVNDVGSDTCSAEIVVKEPPSFIKTLEPADIVRGTNALLQCEISGTGPFEISWFKDKK
QIRSSKKYRLFSQKSLVSLEIFSFNSADVGEYECVVANEVGKCGCSATHLLKEPPTFVKK
VDDFTALAGQTVTLQAAVRGSEPISVTWMKGQEILKEDGKIKTSFSNGVATLIIPDVQIS
HGDKYTCLAENEAGSQTSVGELIVKEPAKIVERAELVQVTAGDPATLEYTVTGTPELKPK
WYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEVSNEVGSSSCETTFTVLDR
DIAPFFTKPLRNVASVVGSACRLDCRIAGSLPMRVAWFKDGRELASGDKYRAAFVEGTAS
LEIHGVDLSDAGTFTCRATNSVGSKDSSGALVVQEPPSFVTKPASKDVLPGSAVCLKSTF
RGSGPFTVRWLKGGRELVSGGSCYITKEASESSLELYVVKTSDSGTYTCQVGNAAGSVEC
SANLFVKEPATFIEKLEPSQLLKKGDSTQLACKVAGTPPIKITWFANDRELKEGGRHRMS
FVESTAVLSLTEVTTEDSGEYMCEAQNEAGSDHCGSILIVKESPYFTKEFKPVEVLKEYD
VMLLAEVAGTPPFDITWFKDNTTLRSGRKYKTFIQDQLVSLQILKFVATDAGEYQCRVTN
EVGSSTCSARVTLREPPSFVKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDNDEITED
DNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSID
VTQGDPATLQVKFSGTKEITARWFKDGQELTLGQKYKISVTDTVSILKIISTEKRDSGEY
TFEVQNDVGRSSCKASINVLDLIIPPSFTKRLKKMDSIKGSSIDLECIVAGSHPISIQWF
KDDQEISASEKYKFSFHDNTAFLEISHLEGSDSGTYTCSATNKAGHNQCSGHLTVKEPPY
FVEKPQSQDVNPSTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTILELFS
AKSADSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTP
EIRVSWYLDGNEITAIKKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIEL
KVKEPPTFIRELKPVEVVKDSDVQLECEVAGTAPFEVTWLRNNKEIRSSKKYTLTDRVSV
FSLHITKCDPSDTGDYQCIVSNEGGSCSSSTKVSLKEPPSFIKKIENVTTVLKSSGTFQS
TVAGSPPISITWLKDDHILEEDDNVHISFVNNVATLQIRAVDNGHSGRYTCQAKNESGVE
RCYAFLLVQEPAQILEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSM
SFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKI
LGSSIRMECKVSGSLPISAQWFKDGKEVSTSAKYRLVCHENTVSLEVNNLELEDTANYTC
KVSNVAGDDACSGILTVKEPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVE
LASGPTCFIGLEGSTSFLNLYSVDASKTGQYTCQVTNDVGSDSCTTMLLVTEPPKFVKKL
EASKIVKAGDSARLECKITGSPEIRVVWYRNEHELQASDKYRMTFIDSVAVLQMNNLGTE
DSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPVVETLKNTEVSLECELSGTPPFEVI
WYKDKRQLRSSKKYKIASKNFHASIHILNVETSDIGEYHCKAQNEVGSDTCICTVKLKEP
PRFVSKLNSLTVVAGEPAELQAYIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQ
FAKAEPANAGKYICQIKNDGGMRENMATLTVLEPAVIVEKAGPMTVTVGETCTLECKVAG
TPELSVEWYKDGKLLTSSQKHKFSFYNKISTLKILSVERQDAGTYTFQVQNNVGKSSCTA
VVDVSDRMVPPSFTRRLRDTVGVLGTSCILECKVAGSSPISVAWFHEKTKIVSGAKYQTT
FSDNVCTLQLNSLDSSDMGSYTCVAANAAGSDECRAALAVQEPPSFVKEPEPLEILPGKN
VTFTSVIRGTPPFKVGWFRGARELVRGDQCNIYFEDTVAELELFNVDISQSGEYTCVVSN
NAGQTSCTTRLFVKEPATFVKKLSDHSVEPGKSIILESTYTGTLPIAVTWKKDGFNISQS
ERCSIVTTEKTCILEILNSTKKDAGQYSCEIENEAGKDVCKALVSTLEPPYFVTELEPLE
ASVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEY
TCKAENSIGTAASKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWY
RDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLAVREPKK
SPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLR
ILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASQVAKHGESIQLECKIS
GSPEIKVQWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCS
TALTVKAPPVFTQKPSPVGALKGSDVIFQCEISGTPPFEVVWVKDRKQVRSSKKFKITSK
NFDTSLHILNLEASDVGEYHCKATNEVGSDTCVCSVKFKEPPRFVKKLSDTSTLVGDAVE
LRAVVEGFQPISVVWLKDKGEVIRESENTRISFIDNIATLQLGSPKASDSGKYVCQIKND
AGTRECSAVLTVLEPARIVEKPEPMTVTTGNPFALECVVAGTPELSVKWFKDGRELSADS
KHHITFINKVASVKIPCAEMSDKGLYSFEVKNSVGKSTCSVSVHVSDRVVPPSFIRKLKD
TNAILGASAVLECRVSGSAPISVGWFQDGNEVVSGPKCQSSFSENVCTLSLSLLEPSDTG
TYTCVAANVAGSDECSALLTVQEPPSFEQVPDSVEVLPGISLIFTCVIRGTPPFKVKWFK
GSRELVSGESCTISLEDDVTELELLEVEPSQSGDYSCLVTNEAGSASCTAHLFVKEPATF
VKRLADFSVETGSPIVLEATYSGTPPISVSWMKNESPLSQSQNCSITTTEKSTILEITES
TIEDYAQYSCLIENEAGQDICDALVSVLEPPYFIEPLQHVEAVIGEPTTLQCKVDGTPEI
RIAWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDIGEYTCKAENSVGAVASSAVLII
KERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHN
VATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESG
SLKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVSKGDAGQYTCYASNV
AGKDSCSAHLGVQEPPRFIKKLEPSRIVKQDEYTRYECKIGGSPEIKVLWYKDETEIQES
SKFRMSFLDSVAVLEMHNLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPIFRKKPHPVE
TLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILGVDAADIGEY
QCKATNDVGSDTCVASITLKAPPRFVKKLSDISTIVGEEVQLQTTIEGPEPISVVWFKDK
GEIVRESDNIWVSYSENVATLQFARAETANAGKYTCQIKNDAGMQECFATLSVLEPAAIV
EKPESIRVTTGDTCTLECTVTGTPELSTKWFKDGKELTSDSKYKISFFNKVSGLKIINVA
PSDSGVYSFEVQNPVGKDSCTASVQVSDRIVPPSFTRKLKETHGLSGSSVVMECKVYGSP
PISVSWFHEGNEVSSGRKYQTTLTDNTCALTVNMLEESDAGDYTCIATNVAGSDECSAPL
TVREPPSFVQKPEAMDVLTGANVTFTSIIKGTPPFTVSWFKGSSELAPGDRCNVSLEDCV
AELELFGVDTTQSGDYTCIVSNEAGKASCTTHLYVKAPAKFVKRLNDYSIEKGKPLILEG
TYTGTPPISVTWKKNGINITPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKD
SCSAQILILEPPYFVKQLEPVKVTVGDSASLQCQIAGTPEIGVSWYKGDTKLRPTATYKM
HFRNNVATLVFNQVDSNDSGEYICRAENSVGEVSSSTFLSVQEQKLPPSFSRQLRDVQET
VGLPVVFECTINGSEPISVSWYKDGKPLKDGPNVQTSFLDNVATLNIFKTDRSLAGQYSC
TATNPIGSASSSARLILTEGKNPPFFDIPVAPVDAVVGESADFECHVTGTQPIKVTWAKD
NREIRSGGNYQISYLENSAHLTILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPP
SFTKKLSETVEETEGNSFRLEGRVAGSQPITVAWYKNNIEIHPTSNCEITFKNNTLLLHV
KKAGMGDAGLYTCKVSNDAGSALCTSSIVIKEPKKAPVFDQHLTPVTVSEGEFVQLSCHV
QGSEPIRIQWLKAGREIKPSDRCSFSFANGTAVLELKDVAKADSGDYVCKASNAAGSDTS
KSKVTIKDKPAAVPAAKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTK
GKWRQLNQGGRIHIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKK
QEKIEGDLRAMLKKTPVLKKGTGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQA
FEMLKQSQEEETHRLEIEEIEKSEKDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLK
DDEAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKDCQLKDQGNYRL
VCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSSWFRNGRLLKPQGR
HQTAVEHKVHKLTIADVRAEDQGRYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQ
SATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARL
EPRGEARSTAELYLTTKEIKLEMTPPDIPDSRVPIPTMPIRAVPPEEIPAMVVPPIPLLL
PSPEEKKPPAKRIEVTKKAVKKDAKKVVAKPKEEPPQEVAKKPLRPTALIPAEAPEIIDI
SSKAEEVKITTITRKKEVQKEKEAVYEKKRAVYEEKKLFIESLEEPYDELEVEQYAEPFE
EPYYEEPDEDYEETKVEAKREVHEEWEEDFEEGQEYYEREEGYDEGEEEWEETYKEREVI
QVQKEVYEESHERRIPAKVPEKKAVPPPKVVKKPVVEKIEKTSRRMEEEKVQVTKVPEVS
KKMVPQKPSRTPVQEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKKTVT
EEKIHVAVSKKTEPPPKVPEPPKKPVPEEVVAVPIPKKVEPPPAKVPEVPKKPVPEEKKP
VPVPKKEPAAPPKVPEVPKKPVPEEKIPVPVAKKKEAPPAKVPEVQKRVVTEEKITIVTE
REESPPPAVPEIPKKKVPEEKRPVPHIEEEAPPPKVLRKKPVPEEKVPVPVPVAKKAPPP
RAEVSKKTVVEEKRFAAEEKLSVAVPQRVELMRHEEEEWSYSEEEERVSFSVYREEEREE
EEEEVEITEYEVMEEPEEYVVEEKTHFISKRVEAEPAEVLEKHEKKIVMKPKIPAKIEEP
PPAKVPEAPKKIVPEKKVPAAVPKKEKVPPVPEEPKKPVPEKRVPPKVVKEEEPPPTKVA
ERHMQITQEEKVHVAVTKKEEPPRARVPEEPKRAVPEEKIPKPKPKREEEPPAKVTEIRK
RAVKEEKVSIEVPKRKAPPVKEVTVTEEKEWSYVHEEETVSVEREEEYDEIEEYEYKESE
EYEPTEEYDQYEEYEEREFEHYEEYKEHEEYVTEEPKKPLPVKPVQEEPVPRKPKAPPAK
VPKKVVPEEKVPVPIPKKLKPPPPKVTEESKKLVEEKIHISITKREKEQVAEPAVKVPVM
PKRVVTEEKVLVPKKEVTAPVTVPEVPKRQEPEEIVYEEEVVTQVEEYFEEEEEEEEYIH
EEEEFITEEEVVPVIPVKVPEIPKKPVPEEKKPVPVPKKKEAPPAKVPEVPKKPEEKVPV
PVPKKEKPPPAKVPEVPKKPVPEEKVPVPVPKKVEAPPAKVPEVPKKPVPEKKVPVPVPK
KVEAPPAKVPEVPKKVIPEEKKPTPVPKKAEAPPPKVPKKREPVPVPVALLREEEVPFEE
EIAPEEEVLPEEEEVLPEEEEVPPEEEEVPPEEEEVLPEEEEVPPEEEEVPPEEEEVPPE
EEEVPPEEEVEPEEEQVLPEIKPKKPVPARVPEVPKKPVPQKKVPVPAPKKVEPPPSKVP
EVKKKVPEKKVIIHKKEEAPPATVPVVLKKPEPEKKVPPPGLKKAVPPPAKVPEVPKRVE
ETRIILPEEEEVPLVEVYEEPEEPIPEEEIPEEPPSIEEFEEVVPPRVPEVVKKAVPEVP
TPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEPPPAKVPEKKVPEKKIAEKKVPVPKKEAV
PPAKGRTVYEEKVSVAFHKEEVVRERTELEVVETPVEVLEEEEFHEVQEYFEEEEFHEVE
EFIRVEKPRMEEVHRAEEVHRVIEFLETEEVEVYEKPKAPPKGPEISEKVIPPKKPPTKV
VPRKEPPAKVPEAPKKIVVEEKVRVPEEPTFPPAKVPEAPKEVVPEKKVRVPPPKKPEVP
SVTVPEAPEEVVPEKKVRVPPPKKPEVPPVTVPEAPKEVVPEKKVHVAPPKKPEVPPVKV
PEAPKEVVPEKKVRVPPPKKPEVPPVTVPEAPKEVVPEKKVPAAPPKKPEVPPAKVPEVP
KAAVPEKKVPEVIPPKPESPPPPVHEEPEEVAWEEPPAEAVEEPEPAPPPKVAVPPKKPV
PEKKPPAIVAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKPEVPPAKVPEVPKEVVAEKK
VTVPKKPEVPPPKVPEVPKKPVFEEEPAIPVPEKAESPPPEVYEEPEEIAPEEEEPVPVA
EEEEPEAPPPAVPEEPKKIVPEKKVPVIKKPEAPPPKEPEPEPEKKVVEKPKLKPKPAAP
PPAPPKEDVKEKMFQLKAVSKKKVPEKPEVPEKVELKPLKVPGAEKKVRKLLPEPKPQPK
EEVVLKSVLRKRPEEEEPKVEPKKLEKIKKPVPEPPPKAVEEAEVPPAPVTKRERKIPEP
VKVPEIKPAIPLPGPEPKPKPEPEVKVIKPPPVEPAPTPIAAPVTVPVVGKKAEAKAPKE
EAAKPKGPIKGIPKKTPSPIEVERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDI
VLTEAESVGSSAIFECLVSPSTAITSWMKDGSNIRESPKHRFIADGKDRKLHIMDVQLSD
AGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVW
RKDGKIVVEKPGKIVPGVIGLLRALTINDADDQDAGTYTVTVENANNLECSSCVKVVEVI
RDWLVKPIRDQHVKPKGTAVFTCVIAKDTPNIKWFKGYDEIPLEPNDKTEIVREGNHLFL
KVKNATPEDIDEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEAD
IPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAFTTAILTVKEI
ELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVIN
DSHFDDEGVYTAEVEGKKSSARLFVTGIRLKFISPLEDQTVKEGQTATFVCELSHEKMHV
VWFKNDAKLHTSRTVLISSEGKTHKLEIREVTLDDISQIRAQVKDLSSTANLKVLEADPY
FTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSAKYSIKTDGLRRILKIKKAE
LKDKGEYMCDCGTDQTKANVTVEARLIKVEKPLYGVELFVGETARFEIELSEPDVHGQWK
LKGEPLTASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAANAKSAANLKVKELPLIFIT
PLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDKVELIKDGTKHSLVIKSAAFE
DEGKYIFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKERESAVFTVELSHDNIRVKWFKN
DQRLHTSRSVWMDDEGKTHSITFRDLSIDDTSQIKVEAMGLSSEAKLTVLEGDPYFTGKL
QDYTGVEKDEVILQCEISKADAPVKWFKDGEEIKPSKNVVIKADGKKRILILKKALKSDI
GQYTCDCGTDKTSGKLNIEDREIKLVRPLHSVEVMETETARFETEISEEDIHANWKLKGE
ALLQTPDCEIKEEGKMHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKD
VTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSEKVVPRSEGKVHTLTLRDVKLEDAGE
VQLRAKDFKTHANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEI
LKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ
VKEKEMARFECEISRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYS
CEVKTARTSGMLTVLAEEAVFTKNLGNIEVSETDTIKLVCEVSKPGAEVTWYKGDEEIIE
TGRYEILTDGRKRILIIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEVL
EGEKAEFVCSISKENFEVQWKRDDKTLEPGDKYDIIADGKKRILVVKDATLQDMGTYVVM
VGAARAAAHLTVIEKLRIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSK
YIILQKDLVYTLRIRDARLDDQANYSVSLTNHRGENVKSAANLIVEEEDLRIIEPLKDIE
TMEKKTVTFWCKVNRLNVTLKWTRNGEEVAFDNRVTYRIDKYKHSLIIKDCGFPDEGEYV
VTAGQDKSVAELLIIEAPTEFIEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKE
GKKYKFEKEGSTHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEA
PGTDVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICNIQPRDQGEYRFI
AKDKEARAKLELAAAPKIKTGDQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEPLSSKT
VDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEAFINLRVIDVPGPVRNLEVTETFDG
EVSLGWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRV
SARNRVGTGEPVETDNPVEARSKYDVPGPPLNVAITDINRFGVSLTWEPPEYDGGAEITN
YVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVK
VADPIERPSPPVNLSSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNWIRCNKK
LVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGL
EVIVPNPIKILVPSTGYPRPHATWSFGDKVLEAGDRVKMKTISAYAELVISPSERPDKGI
YTLKLENPVKAISGEIDVNVIARPSAPKELKFGEITRDSVHLTWEPPDDDGGSPLTGYVV
QKREVSRKTWTKVIDLVTDLEFTVPDLVQGKEYLFKVCACNKCGPGEPAYVDEPVNMSAP
ATVPDPPENVKWRDRTANSIFLTWDPPKYDGGSRIKGYIVEKCPRGSDRWVACGEPVADT
KMEVTGLEEGQWYAYRVKALNRQGASKPSKPTDEIQAVDTQEAPEIFLDVKLLAGLTVKA
GTKIELPATVTGKPEPTITWTKADMLLKQDKRITIENVPKKSTVTILDSKRSDTGTYIIE
AVNVCGRATAVVEVNVLDKPGPPAAFDVTEVTNESCLLTWNPPRDDGGSKITNYVVERRA
TDSEVWHKLSSTVKDTNYKATKLTPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPG
PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRV
KGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDVGKTSLMLNW
TKPEHDGGAKIESYIIEMLKTGTEDWVRVAEGVPTTQHLLTGLMEGQEYSFRVRAVNKAG
ESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRD
VRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEIEDSVLAKDTFTTP
GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTAGPDCNFR
VTDVIEGTEVQFQVRAENEAGVGHPSEPTELLSIEDPKGPPSPPLDLHVTDAGRKHIAIA
WKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVN
AVGVSEPSEISENVVAKDPDCQPTIDMETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDG
KEVKASDRLTMKNDHISAHLEVPKSVHADAGIYTITLENKLGSATGSINVKVIGLPGPCK
DIKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLI
PNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTANAMTITWKPPL
YDGGSKIMGYIIEKIAKGEDKWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISE
PSRATPPTKAVDPIDAPKVIMRTSLEVKRGDEIALDATISGSPYPTITWLKDEKVIIPEE
IKKRVAPTVRRKRGEVQEEEPFVLPLTERLSIDNSKKGESQLRVRDSIRPDHGLFMIKAE
NDHGIAKAPCTVSVLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEIINYTLEKKDKT
KPDSEWIIITATLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLIAKDPFEPPD
APDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNRSLLNSLKTNVE
GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPPVPRVTDTSSTTIDLEWEP
PAFNGGGEIVGYYVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGE
GPPGETGPVTVAEPQEPPTVELDVSVKAGIQIMAGKTLRIPAVVTGRPVPTKVWTIEEGE
LDKDRVVIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLK
PVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQE
YMFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGS
PIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVEDLDEHQMYEFRVKAVNEIGESEPSLPL
NVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTD
ALKITKEEVSRSEAKTELIIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL
AVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVEKRYGVWKLI
PNGQYEFRVRAVNKYGISDECKSDKVVIQDPFRPPGPPGKPKVLERTKGSMLVSWTPPLD
NGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVPRLTEGVKYQFRAMAINAA
GVGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQ
EEGSTDWKKVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEILATDI
QEPPEVFIDIGAQDSLVCQAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAVKDGVHDVPED
AQVETAENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT
RGSCRLTWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTSFVVPDLISEQQYFFR
VRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVT
HYIVECLAWDPTGTKKEAWKQCNKRDVEELEFTVEDLIEGGEYEFRVKAVNAAGVSKPSA
TVGPVTVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGMPFPTLTWFKAPPRKPDKKEPV
VYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPI
KFENISADQMTLSWLPPLDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEG
HEYVFRIMAQNKFGVGEPLDSEPETARNLFSVPGPPDKPTVSSVTRNSMTVNWEEPEYDG
GSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVG
PASLPSDPVTARDPIAPPGPPIPKVTDWTKSSVDLEWSPPLKDGGSKVTGYIVEYKEEGK
EEWEQGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRIVSPDL
QLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERALPQEATIETTAISSSMVIKN
CQRSHQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGIPFQAHNLTNDSCKLTWFSPEDDG
GSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSVGIGPFTET
PTALVIRDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVLESRLIGTEKFH
KVTKDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDDLAPPTLDLDF
RDKITIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPTTLALEKIKAKRS
DSGKYCVVVENTTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEI
TNYIIEKKEVGKDIWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMK
ARDRFRVPDAPDQPIVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWARVTREP
IHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDT
TCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETKYKVTGLRDGQT
YKFRVMAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAVIKG
VPFPKVTWKKGDREAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKV
LVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSTTSK
KKSHLAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKT
EVSLVWNKPDRDGGSPITGYLVEYQEEGTEDWIKFKTVTNLECVVTGLQQGKTYRFRVKA
ENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKW
TTDGTEIKTDEHYTVETDSFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVP
GPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLK
IPHLQKGCEYIFRVRAENKMGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSW
TLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAG
LSNPSPSSDPIKACRPIKPPGPPINPKLKDKTKETADLVWTKPLSDGGSPILGYVVECQK
PGTTQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILH
PPEVELDVTCRDVITVRVGQTIRILARVRGRPDPDITWSKEGKVLVREKRVDIIQDLPRV
ELQIKEAVRADHGKYIISAKNSSGHAQGFTIVNVLDRPGPCQNLRVSNVTKENCTISWEN
PLDNGGSEITNFIVEYRKPNQKGWSIVASDATKRLIKANLLANNEYYFRVCAENKVGVGP
TIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGS
DDWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLD
LKLSGVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDATDLTRSPRVKIDTSADSSKFSLT
KAKRSDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDG
GCEIQNYILEKCESKRMVWSTYSANVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTES
KPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKERHSTRWVP
VNKSAIPERRLKVQNLLPGHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNLK
VVDTTKSSITLGWGKPVYDGGAPIIGYVVEMRPKREDTSPDEGWKRCNAAAQLVRMEFTV
TSLDENQEYEFRVCAQNQAGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPI
RLFAIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPA
GEKAVFVNVRVLDTPGPVTDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVEKREAERKT
WSTVNPEVKKTSCQVTNLVPGNEYYFRVTAVNEYGPGVPADVPKPVLASDPLCEPDPPRK
LEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLK
EGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRVEAHVYG
KPHPVCKWKKGEDDVVTSSHLAVHKADTSSILIIKDVTRKDSGYYSLTAENSSGTDTQKI
KIIVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALA
SVTKTSCRIGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFGVPSEPKNARVTKVN
KDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSLEYPCAGLVEGLEYSF
RIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDISKNTVSLIWARPKHDGGSKIIGY
FVEACKLPGDKWVRCNTSPHQIPQEEYTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPV
TIQAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKEGTLLKPSEGIKM
AMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADR
AMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICA
ENKYGVGDPIFTEPAVAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLV
EKRETHAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYAQD
PLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKL
QKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLI
LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKY
ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWDPPIIDGGSPIINYVVE
KRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETP
GPVVDLKVISVTKSSCNIGWKKPRSDGGSRIIGYVVDFLTEDNKWQRVMKSLSLQYSAKD
LTEGKEYTFRVSAENENGEGTPSEITAVAKDDIVAPDLDLKDIPDLCYLAKENSNFRLKI
PIKGKPAPSVSWKKGEDPLATDTRVSVESTAVNTTLVVHDCQKSDAGKYTITLKNVAGTK
EGTLSIKVVGKPGIPTGPIKFEEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVNNKWV
TCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSDPVVAKHPFDVPDAPPPPNI
VEVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLMWKRANKTPIRMKDFKVTGLTEGL
EYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHK
LTGYIVEKRDLPSKSWTKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSEST
GTVICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLSAISIHGKPLPKSSWSRAGKDIRPSD
IVQISSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNV
SAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYVF
RVSAVNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEIT
GYHIERREKKSLRWVRATKMPVSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSEASNPV
LMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYIVEHQKVGDEAWIKDTT
GTALRITQFVVPDLQTKEKYNFRIRAINDAGIGEPAVIPDVEIVEREMAPDFELDAELRR
TLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINLKNRANIENTESFTLLIIPECNRYDTGK
FVMTIENAAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIV
EKREATRKSYSTVSTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPAETTEPVKASEA
PSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVV
KNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIK
VEIPVLGRPKPTVTWKKGDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTARNIV
GEVGDVITIQVHDIPGPPTGPIRFDEVSSDFVTFSWDPPENDGGVPISNYIVEMRQTDST
TWVELATTVIRTTYKATRLTTGVEYQFRVKAQNRYGVGPGITSTPIVANYPFKVPGPPGT
PQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSSGLT
DGIAYEFRVIAENLAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTG
GFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAVSPPS
EPSDAITCRDDIEAPKIMVDVKFKDTIILKAGEAFKLEADVSGRPLPTMEWTKDGKELEG
TAKLEIRIADFSTYLINKDSTRRDSGAYILTATNPGGFAKHIFNVRVLDRPGPPEGPLAV
SEVTAEKCVLSWLPPLDDGGAKIEHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNE
YIFRVMAVNKYGVGEPLESEPVLAVNPFRPPDPPKNPEVTAITKDSMVVCWGHPDSDGGS
EIINYIVERRDKAGQRWVKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSSTS
PFYKACDAVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYIVEIARPEEDEWQI
VTPPAGLKATSYTITNLVENQEYKIRIYAMNSEGMGEPALVPGTPKAEERMLPPEIELDA
DLRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRF
DSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIK
NYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVK
ASERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVT
EATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFTTFTVLAGED
LKVDVPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTN
SAGEATETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTS
TTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVIAQYPFKVPGPP
GTPFVTLFSKDSMEVQWNEPVSDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTG
LDEGIEYEFRVSAENIVGIGKPSKVSECYMARDPCDPPGRPEAIIVTRNSVTLQWKKPTY
DGGSKITGYIVEKKELPDGRWMKASFTNVIDTQFEVTGLVEDQRYEFRVIARNAAGVFSE
PSESTGAITARDEVDPPRISMDPKYKDTIVLHAGESFKIDADIHGKPIPTIQWVKGDQEL
SNTARLEIKSTDFATSLSVKDAVRIDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPV
VVSGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTLVDANVQTLSYKVTKLLEG
NEYIFRIMAVNKYGVGEPLESEPVIAKNPFVVPDAPKAPEITTVTKDSMVVVWERPASDG
GSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSL
PSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEW
TMCTPPTGINKTNIEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIEL
DLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVN
RYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSK
IKNYIVEKREATRKSYAAVVTNCHKNSWKIEQLQEGCSYYFRVTAENEYGIGLPAHTADP
IKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVK
SLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPVVAKDLVIEPDVRPAFSNYSVQVG
QDLKIEVPISGRPKPTITWTKDGLPLKQTTRVNVTDSPDLTVLSIKETHKDDGGHYGITV
ANVVGQKTASIEVITLDKPDPPKGPVKFDEVSAESITLSWNPPTYTGGCQITNYIVQKRD
TTTTVWDTVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPIVAQYPYKEPG
PPGTPFVTAISKDAMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKA
LNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIMVKRNEITLQWTKP
EYDGGSMITGYIIEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGVI
SKPSDSTGPITARDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDK
EIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEG
PVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKITKLL
EGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVPPGPPKSLEVTNIAKDSMTVCWNRPDS
DGGSEIIGYIVEKRDRSGIRWIKCSKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEP
SPATVYYKACDPIFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEIIGYVVELCKADEE
EWQIVTPQTGLRATRFEISKLIEHQEYKIRVSALNKVGLGEATSVPGTVKPEDKLEAPEL
DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDN
CDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLTVKEVKKDSVLLVWEPPIIDGG
AKVKNYVIDKRESTRKAYANVSSKCGKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETV
DAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSTVAE
SKVCSAVITGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSFKLPFNTYTVQ
AGEDLKIEIPVIGRPRPEISWVKDGEPFKQTTRVNVEETATSTILHIKESNKDDFGKYTI
TATNSAGTATENLSIIVLEKPGPPTGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEK
RDTTTTTWQMVSATVARTTIKVTKLKTGTEYQFRIFAENRYGKSAPLDSKPVVVQYPFKE
PGPPGTPFVTSISKDQMIVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKIPIQDTKF
KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWK
KPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAG
NFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWSKD
GKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGP
PEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVT
KLLPGNEYIFRVMAVNKYGIGEPLESEPVIARNPYKPPGPPSPPEASAITKDSMVVTWAR
PVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGV
GEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEA
SADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATIPGSVVAKERLEP
PEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLV
IDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLNVREVKKDSVILSWEPPLI
DGGAKITNYIVEKRETTRKAYATVTNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPA
ETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST
CTQVKTLEATISGLTAGEEYTFRVAAVNEKGRGDPRQLGVPVIARDIEIKPSVELPFNTF
NVKARDQLKIDVPFKGRPQATVSWKKDGQILKETTRVNVSSSKTVTSLSIKEASREDVGT
YELCVSNSAGAITVPITVIVLDKPGPPGPVHIDEVSCDNVTISWNPPEYDGGCQISNYIV
EKRETTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRVCAENRFGRSSYSESAPVVAEYPF
SPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKILIADT
QMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLK
WSKPHYDGGAKITGYIIERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFAKNA
ADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWA
KDGVEIEERARTEIVSTDYNTVLTVKDCVRRDTGQYILTLKNVAGTRSMAVNCKVLDKPG
PPAGPLEISGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSRLAWTICEGELRTTSCKV
TKLLKGNEYIFRVTGVNKYGVGESLESTAVKALNPFTVPSPPTSLEITSVTKEFMTLCWS
RPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAG
LSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTNITISWVKPLFDGGAPVTGYTVEYKK
SDETEWETAIQNLRGTEYTIGGLTTGAEYVFRVRSVNKIGASDPSDSSDPQIAKEREEEP
VFDLDSEMKKTLIVKAGSSFTMTVPFRGRPVPSVSWSKPDTDLRTRAYIDSTDSRTSLTI
ENANRNDSGKYTLTIQNILNAASLTLVVKVLDSPGPPANITVHDITKESAVLSWDVPEND
GGAPVKNYHIEKREASKKSWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVPAE
TKEGVKITEKPSPPEKLGVTGVSKDSVSLTWLKPEHDGGSRIVHYIVEAVEKGQKNWVRC
AVVKSTHHIVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPDIDMKNFPSH
TVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEVTAENLTINLKESVTTDA
GRYEITAANSSGTTKAFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTN
YIVLKRETSTTVWTEVSTTVARTTIKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVK
LPYTTPGPPSTPWVTNVTRESITVAWHEPVSNGGSAVIGYHLEMKDRNSILWQKANKLVI
RTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSV
SLSWLQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFIVSGLTQNSQYEFRVFA
RNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTI
EWYKDDKELQTNALVCIENTTDLASVLIKDANRLNSGSYELKLRNAMGSASATIRVQILD
KPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSENLEECI
IKTTKIIKGNEYVFRVRAVNKYGIGDPLESEPVVAKNAFVTPGPPGIPEVTKITKNSMTV
VWSRPVADGGSEVSGYYLEKRDKKSLGWFKVLKETIRDTREKVTGLTENSDYQYRVCAVN
AAGQGPFSEPSDFYKAADPIDPPGPPAKIRVADSTKSSITLGWSKPVYDGGSAVTGYVVA
MRQGEEEEWTVVSTKGEVRTTEYVVSNLKPGVNYYFQVSAINCAGQGEPIEMTEPVQAKD
ILEEPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYNIQNTD
SSSLLIIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTL
FWDPPLIDGGSPIINYVIEKRDATKRTWSSVSHKCTSTSFKITDLSEKTPFFFRVLAENE
IGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVTLSWTKPDFDGGSVITEYVVERKGK
GEQMWSHAGISKTCEIEVGQLKEQSLLEFRVFAKNDKGLSDPVTIGPITVKELVITPDVD
LSDIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIK
NVKKENGGKYTVILDNAVCRTSIPITIITLGPPSKPKGPIRFDEIKADSVIMSWDVPEDD
GGGEITCYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLV
SNTIVAKHQFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQ
RVNTSPISGREYRATGLMEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI
DVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRY
EFRIIARNAVGTISPPSQSSGIIMTRDENVPPTVEFGPEYFDGIIIKSGESLRIKALVQG
RPVPRVTWFRDGVEIEKKMNMEITDVLGSTSLFVRDATREHRGVYRVEAKNASGSSKAEI
TVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED
NCQAHSYTATKLITGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTIPDAPGTPEPSNVT
GNSITLTWARPESDGGNEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLIEGNEYE
FHVMAENAAGIGPPSGISRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGME
IIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGESSEATG
AIKAVDRLAAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIRADI
HTTDSFSTLTVENCNRNDAGKYTFTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGS
VTLMWDAPILDGGARIHHYVVEKREASRRSWQVISEKCTRQILKVSDLAEGVPYYFRVSA
ENEYGVGEPYEMPEPIVATEQPAPPKRLDVIDTSKSSAVLAWLKPDHDGGSRITGYLLEM
RQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIE
PTADLTGITNQLITCKAGSTFTIDVPITGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT
LSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSISAESCVLSWAE
PKDDGGTDITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVS
KPLESAPIIAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNT
ILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGR
PEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVT
ALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSD
LVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKN
ASGTKSVSVLVKVLDSPGPCGKLTVSRITEEKCTLAWSLPQEDGGAEITHYIVERRETSR
LNWVIVEAECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSQPG
IPEEVGAGKEHIIIQWTKPESDGGNEIKNYLVDKREKKSLRWTRVNKDYVIYDTRLKVTG
LMEGCDYQFRVTAVNAAGNSEPSEASNFIACREPSYTPGPPSAPRVVDTTKYSISLAWTK
PLYDGGTDITGYVLEMREKDTDQWYRVHTKATIRNNEFTVPDLKMGQKYSFRVAAVNVKG
MSEYSESTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWTKKG
IDLANRAIIDTTDSYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSV
KVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEG
TMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGS
RLTGYVLEACRAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIV
TAVTVRDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESER
VTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEI
DATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRQTFKFTRLTEGNEYVF
RVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPENDGGSQVT
GYIIERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPSRPSKPI
VAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNT
TPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQE
GIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDVSKRAMIATSETHTELVIKEADRDDSGT
YDLVLENKCGKKTVYIKVRVIGNPNPPEGPLEYDDIQARSVRVSWRPPADDGGADILGYI
LERREVSKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKSLKSEEPVIPKT
PLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQI
TTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISK
DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKDRIKDRQFTIGGLLESTEYEFR
VFAENETGLSRPRRTAMSIRTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLPDI
KWYRFGKELVQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA
TPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPSITWFYGQKLLQNSENITIENTEHYT
HLVMKNVQRKTHAGKYKVQLSNIFGTVDSILDVEIQDKPDKPTGPLVIEALLKNSVVISW
KPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTF
GISEPLEVASVVIIKSPFEKPGAPGKPTITALTKDSCVVAWKPPASDGGAKIRNYYLEKR
EKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPATPKSDVP
IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGY
HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEV
VSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAK
NRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIIEKCATT
AERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNY
DEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKV
KGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELN
EREIVSYVRQVCEALEFLHSHNIGHFDIRPENIIYQTRRSSIIKIIEFGQARQLKPGDNF
RLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQMIENIMNAEY
TFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRR
YYHTLIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGY
AKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYQDGVATMYVKDITRFDDGTYRCKVV
NDYGEDSSYAELFVKGVRETYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVG
ENVRFGVTITVHPEPRVTWYKSGQKIKPGDDDGKYTFESDKGLYQLTISNVTIDDDAEYT
VVARNKYGEDSCKAKLTVTPHPPPTDTTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPP
TLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQ
VERLRYVKQEFKSQEERERHVQRQIDKTLRMAEILSGTETVSLTQVAQEALREAAVLYKP
AVSTKTVKGEFRLETEEKKEERRLRMPYEVPEPRRYKQSSVEEDQRIKQFVPMSDMKWYK
KIRDQFEMPGKIDRIVQKRPKRIRLSRWEQFYVMPLPRITDQYRPRWRLPKLSQDDLEMV
RPARRRTPSPDYDYDYHFYYRPRRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLEEELE
LGFSASPPSRSPPRFELSSLRAPVSVEETRRDFSSSTYHVPTRADTSTSYAALRERHARA
SHRPPGQRQRMLADREDEELLRPVATSQRLSEYKSQLDHMSREDKSRRKSRRQREVTEIT
EIEEEYEISKHAQREASVHAQRASESESSSVSRLLRRRRSLSPTYIELMRPVSELIRPRR
IPPEDEYEEDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQ
KTSERMYEVLSQQPFTLDHAPRVTLRMRSHRVPVGQNTHFILNVQSKPTAEVKWYHNGVE
LQESSKIRYTNMSGVLTLEILDCQAEDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYAS
RRRDEQVPPSVFPELTRTEEYAVSSFKRTAEMEASSAVREMKSQVTETRESISAYEHHAS
AETRSAAVEQMALEEKSTHRKIKTTLAARILTKPRSITVYEGESARFSCDTDGEPVPTVT
WLRGGQVVSTSARHQVTTAKYKSTFEISSVQASDEGNYSVVVENSEGRQEAQFTLTIQKA
RVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPATSHPKAVSPPETKPTPTEKVQQ
LPVSVPPKITQSLKAEASKDVAKLTCAVESSVLCAKEVTWYKDGKKLKENGHFQFHYSAD
GIYELKIHNLTESDSGEYICEIASEGGTSKTSFQFMGQAFKSVHEQVSRISETKKAAQKT
AESTETKKIEPKAPEPVSSKPVIVTGLQDTTASSDGVAKFAVKATGEPRPTVTWTKDGKA
VTQGSKYKLSEDKGVFLLEVLKTDTSDSGLYTCTVTNSAGSVSSSCKLTIKAVKDTEAQK
ISTQKTSEIVSQKKATVQEEISQKALISEEMKISEVKSQEKLALKEEASKVQISEKVKKS
EAISLEKSIVHEEITKTSQASEEIQRHAEIKASSTQMSITDGQKVTLKANIAGATDVKWV
LNGVELTNSEEYRYGVSGSDQTLTIKQAGHKDEGILTCIGKTSQGIIKCQYDLSLSKELS
NAPAFISQPRSQNINEGQNAVFSCEISGEPSPEIEWFKNNLPISVSSNISVSRSRNVYSL
EIRNASVSDSGKYTVKAKNFRGQCSATASLTVLPLVEEPPREVVLRTSGDTSLQGSFSSQ
SVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSRTQ
LESSTSRMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWSRAGRKIQN
QEQHGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSI
NT seq 103662 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttaagcagccgttacaaagtgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggtttcccagttcctgaggtgagctggttt
agggatggccaggcaatttccacgtccactctgcccggcgtgcagatctcctttagcgaa
ggccgcgctagactgacgatccccgccgtgactcaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcagag
accgcaccacccaactttgtacaacgactgcagagcatgaccgtgagacaaggaagccaa
gttcgactccaagtgagagtgaccggaatccctacacctgtggtgaagttctaccgggac
ggagcagaaatccagagctcccttgattttcaaatttcccaagaaggcgacctctacagc
ctagtgattgcagaagcataccccgaagactccgggacctattcggtaaatgccaccaat
agcgtgggaagagctacttcaacggccgaattgctggttcaaggtgaggacgtcgtaccc
gctaagaagacaaaaaccattgtttcgactgctcagatttcagaaacaagacaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaatcgcaacagttgagatggtc
ctggatggtgccactgggcaacagctgccacataagacccctcccaggatacctcccaag
cccaagtccaggtccccgacgccgccgtcggccgcggccaaagcacagctggcccgccag
cagtccccatcgcccatacgacactccccgtcgcccgtccgccacgtgcgggccccgacc
ccttctccagtcagatccgtgtccccggcggggaggatctccacgtcccccatcaggtcc
gtcaagtccccgctgctggtccgcaagacccaggcgcccggcgtgaccccggggcccgag
gtgcctccgccttggaagcaggagggctttgtggcctcgtcggaggccgagatgagagag
accacggtgacgagcaccacccagatccggacggaggagagatgggaagggaggttcggg
gtgcaggagcaagtgaccgtgagccgcgccgcgggggccgcaggggccgtggaggtacgg
gggctgcggggtcggggctgcggggtcggtgccggggtcggggctgcagggtcctcggtg
ctaggggtggggtgggtgctgcggggtcctgggtgctgcaaggtgggtgctgcggcgtct
gtgcagcgaggtggatgctgcggggtcctcagtgctgcggagttggggccgcggggtgag
ttccacggggtgggtactgcggggtcctgggtgctgcgaggtgggtgccgcggcatctgt
gcagcgcagtgggttccttggggtgggtactgcgcgaaccgggggtcagatcttggtccc
gccccgcgagaccctcctacccggggaggaaggctttggcggtgcccgaggccgcgcgct
gtccccaggctgccgggcggctgtgaggactcggcctctccaatccgggtgagtcaagaa
gctgtcaaaagcgcagctgtcgcgaccgtcgttgctgctgtggacatggccagagtgcga
gaaccggtcaccagcgctgtagagcaggctgcccagaggacaaccacgactgctgtgcat
gtccaacctgctcaggaacagattaaaaaagaggcagagaagaagacggctgtaactaaa
gtagtagtggccgccgacaaaaccaaggaacaagaattaaaatccagaaccagagaagta
attacaacaaaacaagagcaggtgcacgtaactcatgaacagataagaaaagaaactgaa
aaagcatttgtaccaaaagtaataatttctgcagctaaagccaaagagcaagaaactaga
gtttctggacaaattactacaaaacaagaacaaaaacaagtaactcaagaaacaataata
cagaaagctgtgatagctgctgcgtccgtggtggtagctgccactgcagagcccacaaaa
ctagaaacaatgctgggagctcaagaagaaattgccacacatgatcaaatgcacgtaact
caggaaaagatgatgaaagaaactagaaaaacagtggtccctaaagtcatagttgccact
cccaaagtcaaagaacaagatttagtatcaagaactagagaaggcatcactaccaaaaga
gagcaagttcaaataactcatgaaaagatgagaaaggaagctgagaaaactgccttgtct
acaatagcagttgctactgctaaagcccaagaacaagaaacaatattgagaactagagaa
ggaatggctactagacaagaacaaattcaagttactcatggaaaggtggacgttgggaaa
aaggcagaagctgtagcaacagttgtcgctgcagtagaccaggcccgtgtcagagaaccc
agggagcccgggcctcctagagaatcatacgctcagcagaccactttggagtatggctac
aaggagcacatttctgccacaaaggtagctgagcatccccagcgtccagcctcagaaccc
cacgttgtccctaaagcagtcaagcctagagtgatccaggctccttctgagactcatatc
acaactactgatcaaatgggaatgcacatttcatcacagatcaagaaaactacagatata
acaactgaaagattagtccatgtggataaacgcccccgcacagcaagccctcactttact
gtttcaaaaatttccgtccctaagacagaacatggatatgaggcatccatagccggtagt
gctatcgccacgttacagaaagagttgtcagcagcatcttctgctcagaagatcaccaag
tcggtgaaggcacctacggtgaagcctgctgaggctcgagtgagagcagaagccacccct
tccccgcagttccccttcgccgacacgccggacacttacaagagccaagctggcattgaa
gtgaaaaaggaggtgggggtgagcatcaccggtgccaccgtccacgaagagcgcttcaca
gtacgccgcgagcacgaagccaaggtaacagaaacggcgagagtacctgcgcccgttgaa
atcccggttactccaccaaccttggtctcgggcttaaaaaatgtgactgttatagaaggt
gaatccgtcaccttggagtgccacatctctggatacccatcccccaaagtgacatggtac
agagaagactaccaaatagaaagttccattgatttccagataaccttccagagtggaatt
gctcgtcttatgattcgcgaagccttcgcggaagacagtggacgatttacctgcagtgct
gtgaacgaggctgggaccgtcagcacatcctgctatctagctgtgcaagcatcagaagaa
tttgaaaaggaaacaaccgtgactgagaaattgaccaccgaagagaaacgctttgtagag
tcaagagatgtggtaatgacggatactagcatcacagaggaacaagcagagcccggagaa
cctgccgctcctttctttattacaaaaccagtggtccagaaactggtggaaggtgggagc
attgtgtttgaatgtcaagttggaggcaatccaaagccccacgtctactggaaaaaatct
ggtgtccctctaaccacgggatacagatacaaagtgagttacaacaagcaaactggggag
tgcagactggtgatttcgatgacttttgccgatgatgctggagaatatactattgttatt
cgtaataagcatggcgagacttctgcatctgcctccctgcttgaagaagctgaatatgag
tcactgatgaagtcccagcaagaaatgctttaccagacacaaatgactgcatttgtgcaa
gaacccaaagttggagaaatggcacctggatttttatactctgattatgaaaaagagtat
gaaaaggaacaggccttaattaggaaaaaaatggccaaagatactgtaatggtcagaact
tttgtagaagaacaggaattccatatttcttcctttgaagagaggcttatcaaagaaatt
gaatacagaataataaagactaccttagaagaacttcttgaagaagatggagaagaaaag
atggcagttgacatttctgaatctgaagctattgaagcaggatttgacttaagaatcaag
aattatagaattcttgaggggatgggtgtcacttttcattgcaagatgtctggatatcca
ttacccaagattgcatggtacaaagatggcaagcgcatcaagcatggagagagataccaa
atggaattcctgcaagatggcagagctagtctgcgcataccagttgttcttccagaagat
gaaggcatctatactgcatttgccagcaatatgaaaggaaatgcaatttgctcagggaaa
ttgtatgtagagcctgctgcgcctcttggtgctccgacttacatacccacaccagagcca
gtgagcagaatcagatctatctctccacgttcagtgagtagatctcctatacgcatgtct
cctgcacggatgtcccctgcaaggatgtcccctgcacggatgtcccctgcaaggatgtcg
cctggacgtaggctggaggaaaccgatgagtcacaacttgagagactgtataagccggtc
tttgtgttaaagcctgcttctttcaaatgtttagaagggcagactgccagatttgactta
aaagttgttggtagacctatgccagagaccttctggtttcatgatggccagcaaattgtc
aatgattatacccataaagtagtcattaaagaagatggtacccaatcgctgattattgtc
cctgcaacgcccagtgattctggggaatggactgtggttgcccaaaacagggcaggcaaa
tcttcaatttcagtgattttaactgtggaagctgtggaacatcaggtaaaaccgatgttc
gtagaaaagcttaaaaatgtcaatataaaggaaggttctcgacttgaaatgaaggtcaga
gctacgggtaatcccaaccctgatattgtatggctgaaaaacagtgacatcattgtacct
cataaatatcccaaaatcagaattgaaggcaccaagggagaagccgcccttaaaattgat
tccaccgtcagccaggattcagcctggtatactgcaactgccattaataaggctggccga
gacaccacgagatgcaaagtgaatgttgaggtcgagtttgcagagcctgaacccgagaga
aaattgatcatcccgcgagggacgtacagagcaaaggagattgcagccccagaactggag
cccctccatctgcgatatggtcaggagcaatgggaagagggtgacctctatgataaagag
aaacaacaaaaaccatttttcaagaaaaaactcacttccttgagactcaagcgctttggg
cctgcccactttgagtgtaggctaacacccattggtgacccaacgatggtggtggaatgg
ctccacgatggaaagccacttgaagcagccaacaggctccgtatgatcaatgagtttggg
tattgcagccttgattatggagttgcatattccagagacagtggtatcattacctgcaga
gctactaacaaatatggaacggatcacacatctgccacacttatcgttaaagatgaaaag
agtcttgtggaagaatctcagttgcctgaggggagggaaggcctacagagaattgaagaa
ttagagaggatggctcacgaaggtgcgctgacaggtgtaacgacagatcagaaagagaag
caaaaaccagacatcgtcttgttcccagagccagtaagagtactggaaggggagaccgct
agattccgatgccgggtgacaggttaccctcaacccaaagtcaactggtacctcaatgga
cagctgatccgcaaaagcaaaaggttcagagttcgctacgatggcattcattatttggac
attgtggactgcaaatcatacgatacgggggaagtcaaggtcaccgccgaaaatcccgaa
ggtgtaatagagcataaggtgaaacttgagatccagcagagggaagattttaggtctgtt
ctcaggcgagccccggaaccaaagcccgagttccacgtacacgaacctggaaaacttcag
tttgaagtacaaaaagtagataggcctgttgataccaccgaagccaaggaagttgtgaaa
ttgaaaagggctgaaagaattacccacgaaaaagtatctgaagagtcagaagagctgcgc
agtaagttcaagcgcagaaccgaggagggatattatgaagccatcactgcggtggagctc
aagtctcggaagaaggatgagtcctatgaagagctcctcaggaagacaaaagatgagctt
ctccactggaccaaagaattaactgaagaggagaagaaagccctcatggaagaaggcaag
atcactatcccgacatttaaacctgataaaattgaactgagtcctagcatggaggcaccg
aaaatctttgaaagaatccaaagccaaacagtgggccaaggatctgatgcacacttccgg
gtcagagtggtggggaaaccagatcctgaatgtgaatggtacaaaaatggtgtcaagatc
gaacgctctgaccgaatctactggtactggcctgaagacaacgtttgtgaactggtcata
agagatgtgactcctgaggactcggccagcatcatggtgaaagccatcaacatagctggc
gaaacctcaagccatgcgttcttacttgtccaagccaagcaatcgatcattttcacgcag
gaattacaagatgtggttgctaaggaaaaggacaccatggcaacctttgaatgtgaaact
tcagagccatttgtcaaagtgaagtggtataaagatggtgtggaggttcatgcgggagat
aagtacaggatgcactctgacaggaaggttcacttcctctccatactgacgattgacacg
gccgacgccgaagactacagctgcgtcctcgtggaagatgaaaacgtaaaaacaacagcg
aaacttattgtcgaaggtgcagtggttgagtttgtgaaagaacttcaggacatcgaagtt
ccggaatcattttcaggagagttagagtgcgtcatatccccagaaaatatagaaggcaaa
tggtatcataatggcgtggagctgaaatccaatggcaaatacacaattacatctcgccgt
ggacgccagaacctcacggttaaggatgtgaccaaagaggaccagggggagtatagcttt
gttgtcgatgggaaaaagacaacctgtaaactcaagatgaaaccccgccccattgctatc
ctacaaggacttagtgatcaaaaagtctgtgaaggtgacatcgttcagcttgaagtgaag
gtctccttagagaacgtggaaggtgtctggatgaaagatggccaagaagtgcagcccagc
gacagggttcacattgtgatagacaaacagtcacacatgctgcttattgaagacatgacc
aaggaggatgctggaaattactccttcaccattccatccctcggactatcaaccagtggg
cgcgtctctgtctacagtgttgatgtgataacacccctaaaggatgttaatgtgcttgag
ggtaccagggctgtgctcgaatgtaaggtctcggtccctgacgtgacctctgttaaatgg
tacttaaatgatgaacaaatcaaacctgatgatcgcgtacaagccattgtcaaaggcact
aagcagcgactagtgattaaccggacccacgcttccgatgaaggaccttacaagctgatg
gttggcagggttgaaacgagctgtgatgtctctgtggaaaaaattaaaattatcagaggt
cttcgtgaccttacctgtacagaaacccaaaacgtggtcttagaagtggagctgtcccac
tcaggaattgatgttttgtggaattttaagggcaaggaaatcaaacccagttccaaatat
aagatcgaagctcatggaaaaatatataagttgacagttctaaatatgatgaaagatgat
gaaggagaatacacattttttgccggagaaaatatgacatctggaaaacttactgtggca
gggggcgccatttccaagccactcacagatcagactgtggctgaatcgcaggaagctgtg
tttgaatgtgaagttgccaacccagattccgaaggcgaatggctgaaggatggcaaacac
ctaccactgagtaacaacatcagaagtgaatctgatggccacaaaaggagacttatcatt
gctgccaccaaattagatgacatcggagaatacacctacaaggtggccacctccaaaaca
tctgccaaactcaaagttgaagctgtcaaaattaagaagactctgaagaacctcacagtg
acagagacgcaggatgctgttttcactgttgagcttactcatcctaatgtaaaaggcgtc
cagtggatcaaaaatggggttgtgctgcaatccaatgacaagtacgacatctcagtcaaa
ggaacagtttacactctcaggattaaaaactgtgctgttgtggatgaatctgtatacggc
ttcaagcttggaaagttaggagccagtgccaggctgcacgttgagactgtcaagatcatt
aaaaagccaaaagatgtgaccgccctggaaaatgccaccgttgcctttgaagttagtgtt
tcccatgacacagttccagtaaaatggttccacaagaatgtggagattaagccaagtgac
aagcacagactggtctcagaaaggaaggtccacaagctgatgctgcagcatatttccccc
gcggacgctggggaatatacagctgtggtggggcaattggaatgcaaagctaaacttttt
gtggagacattacatattacaaaaaccatgaaaaacattgaggtacctgagaccaaaact
gcctccttcgagtgtgaggtatcccacttcaatgtgccttccatgtggctaaagaatggc
gtggagatcgagatgagtgaaaagttcaagatagtcgtgcaagggaaactccaccagctg
atcatcatgaacaccagcactgaggacgcagcggaatatacatttgtctgtggcaatgac
caagtcagcgccaccctgaaagtgaccccaatcatgattacgtccatgctgaaggacatc
aatgctgaagagaaagacaccattacctttgaggtaacagtgaactatgaaggcatctct
tacaaatggttaaagaatggcgtggaaatcaaatcaactgacaggtgtcagatgcgaacc
aagaagcttacgcactcactgaacatcaggaacgttcactttggggatgcagctgagtac
acctttgtggctggaaaagctacatcaacagccaccctttatgtggaagctcgtcatata
gaatttaggaaacacattaaggacattaaggttcttgagaagaagcgtgccatgtttgaa
tgtgaagtttctgaacctgacatcaccgtccagtggatgaaagacggccaagaactgcca
agcgtggatagaataaagatacagaaagagaaatacgtccaccgcctcttcatcccatcc
acccggatgtctgacgccgggcagtacgcagtggtggcgggaggcaacatgtccactgct
aacctctatgtagagggcagagacgttcgcatccgaagtcttaaaagggaggttcaggtt
attgagaaacaacgtgctgtcgttgagtttgaagtcaatgaagacgatgttgatgcccac
tggtataaagatggcattgaaatcaatttccaaattcaagaacgacaccaatatgtggtg
gagagaagaatccaccggatgtttatctctgagaccaggcatagcgatgctggtgaatac
accttcgtggcaggaaggaacaggagttctgttactctctacgtcaatgcaccagaaccg
ccccagattctgcaggagctccagcctgcaactgtgcagtctggcaagcctgcccgcttc
tgtgctgtgatatccggcagaccacagcccaagatttcctggtacaaggaagagcagctg
ctttccactggattcaagtgcaaatttcttcacgatgggcaagagtacacacttctgctc
attgaagccttcccagaggatgcggctgtttatacctgtgaagccaagaatgactatgga
gttgccacaacctcagcctcactctcagtggaagttccagaggtcgtgtctccagatcag
gaaatgccagtttatcctcctgccatcatcaccccgcttcaggacactgtcacttctgag
ggacagccagcccgttttcaatgcagagtttctggaacagatctaaaagtgtcttggtac
agcaaagacaagaaaatcaagccatccaggttctttagaatgactcaatttgaagacact
taccagctggaaatcgctgaagcttatccagaagatgaaggaacttacacttttgttgct
aataatgctatgggtcaagtatcaagcacagccaacttgagactggcagccccagaatca
attttgcacgggaggattgaagagcagattgaggtggagatgaaagagttttctagttct
cttctgtctgctgaggaagaaggatttcaaacctatagctctggccatcagttatctaat
ggaaatgaaacacttgaacttttgtctgcaccttcaattcattcaactacatttgagtcc
aaaaaggaaggccatgttccagttttcatcaaagaagtgtcaaatgctgaaataagcata
ggggatgtggctaaactgtctgttactgtcactggcattcccaagcctaaaattcagtgg
ttctttaaaggagtgatgttaactccttctgctgactacaaatttgtttttgacggcaat
gatcatagtttgatcattctgttcaccaaatttgaggatgagggagagtatacatgtgtt
gccagtaatgaatacggacaggccgtgtgcagtgcctctctaaaaataagttccaaagga
gagggccaaaaagagacagaagcagaaccagtggaaacatttctggagaagtttgaaggt
ccttgtcccccttacttccttaaggagtttaaaccaattcactgcgctcgggggctccca
gctgtctttgagtacgtggtacttggagagcctgcacccactgttacgtggttcaaagaa
agcaaacagctttgcaccaatgtgtatcacactatcattcataatcctgatggttctgga
acattcattgttaatgacccccagagggaagatagtggcctctatgtctgtagagcagag
aatatgtggggtgagtccacctgcactgcagagctgcttgtgcttctagaagatacagac
atgacggatgctctctgcaaagcaaaacccacaccagaggctactaaggattttccagag
atgtcattaaagggtcctgcagttgaggcatctgactcagagcaggaaattgcagctttt
gtaaacagcaccattttgaaagctgcttcagtcgcagaagaaagccagcagctttctcat
gagcatattgttcaaaccagtgaactgagtagtcaagtaactttagtggctgagcaattg
caatccacagtcacgttggagcagaatatgcccgatgcagaaagcaccagggcacgtctt
tccatcaatggcactattcatgttcagcccatcaaggaaccatctcccaatttacagctg
caggttatccagtcccagaaaaccctccccaaggaagatgtcctaatgcttcaagaaccc
gagtcccaggtgatcctatcagaaactgaaaaaatcttcccaagtgccatgtccgtagaa
gaaattagttcattaacggtggagtctatgaaaactttcctagctgaacctgaagggagt
tatccacagtcttcaatagaagaagctccagccccttcatattcaacctctgttgctgag
gaagtacttttatcaaaagaaaagacagtgtctgcaatggacaaagagcaaagcctgccc
cctccaaagcaagaggcacaaagtgctcccatcttgagtcagagcttagctgaggggaac
atggaaagtttaaagggtgctgatgtcatcatctctgaggtccactgtgaaccccaggtc
ccttcagaacacacgtgcacagaagatgaaattgtgatggaaagtgcagatgaactggaa
agcgcagggcaagattttgcagccaggactgaggaaggcaagtccttaaggtttccacta
gcgtatgaggaaaagcaggtactgctcaaggaagagcattctgacaacttggcagtgccc
ctgaaccaaaccagtgagtataaaaaagagcccatggtgataaatggtgtgccagaggtg
caggcaagtgacactctttctaaggaaagtttgctttctggaattccagaagaacaacga
ttaaacctaaaaactcagatccgcagggctttgcaggcagcggtggccagtgagcaacca
agtcttttctctgaatggttaaggaacgttgaaaaggtggaggtgaaggccatccacttc
acccaggagcccaaacgcgttatgtgtacctacctcattacctcagtgaacactctaacg
gaagaactaaccattgccattgaaggcattgaccctcaaatggctgacttgacaactgaa
ctgaaggatgccctgtgctctgttatatgtgaggaaataaacatcttaacagccgaggat
cccagaatccagaaaggagccacaacaggcctgccggaagaaatgggtccttcctcagag
tcacagaaggttgaggccatctgggaaccggaagctgaatctaaatatcttgtctcggtg
gaagaggtcagctgtttccatgtggaaagtcaggtcaaagttggggataccacgggcgtc
cctgatggggtcactccagctgtgagccctgatgagaaacaggctgagataccaaagcca
tcagaggaaaaagagaagctccctggaggtggtgccggggagggtggcgtgggagaggca
caggaagctgagggcagcgcggtcggagaggatggccctgtcatgctcacgcccctggtg
gacactactgcggaggaaggtgacgttgtaaacctcacgtcatccataacaaatgccaaa
gaggtgaattggtattttgagggcaaactggtgcattcagatgaaaagttcaagtgttta
caagatcaaaatacatatacgctagttatccacggagtcaatacagaagagcatcaagga
gcgtatacctgtgaggccttgaacgccaagggaaatgcatcaacttcggccaaactcact
gtagtcaaaagagctgccccagtgatcaaaaggagaatcgagcccctggaagtagctctg
ggccacctcgccaaattcacctgtgaggtccaaattgcccccaatgtccggttccagtgg
ttcaaagctggccgagaaatttatgaaagtgacaagtgttctattcgatcttcaaagtat
gtctccaccctggaaatcctgagaacccaggttgttgactgcggcgagtatacctgcaaa
gcctccaatgagtatggcagcgtcagctgtacagctacactgactgtgacagaggcgtat
ccaccaacattttactccagacctaagtccgttacaacttttgtgggtaagacagccaag
ttcctctgcacagtactaggcacccccgtcattgaaaccatttggcagaaagatggtgct
gcactctcaccctcccctaaccgcaagatttcagaggcagaaaataaacacagtttagaa
ctctcaaatcttacaattcaagatagaggagtttattcttgcaaagcgtcgaacaagttt
ggagctgacatctgccaagctgagttaatcataatcgacaagccgcatttcatcaaagaa
ttagaacccgtgcaatccgctatcaataagaagatccgcctggagtgccaagtagatgaa
gacagaaaagttacagtaacatggaataaagatgggcaaaaactcccccctgggaaagat
cataagatctattttgaagataaaatagcatcacttgagatccctctggccaaactaaaa
gattcaggaacctatgtttgtacagcttccaatgaggctgggagcagctcgtcttcagca
acagttactatcagagagccaccatccttcgtgaagaaggtggacccctcttacttaatg
ctgccaggtgaatcagcgcgcctccattgcaagctgaagggctcacctgtgatccaggtc
acttggtttaaagataacaaagaacttaatgagagtaataccattcgaatgtcttttgtc
aattctgaggctgtgcttgatctgacggatgtcaaagtcacagacagtggcagttactcg
tgcgaagcggtgaatgacgtcggcagtgacacttgcagtgctgaaatagttgtcaaagaa
cctccttctttcatcaaaactcttgagcctgcagatatagtgagaggaacaaatgccctc
cttcagtgtgaaatctcgggcactggaccattcgaaattagctggttcaaagacaagaag
caaattcgaagtagtaaaaagtacaggctgttttctcagaagtctcttgtgtctctggag
atcttctctttcaatagtgcagacgttggtgaatatgaatgtgttgttgctaatgaagtt
gggaagtgtggctgcagtgcaacacacttattaaaagaaccaccaacttttgttaagaaa
gtagatgattttaccgcgctagcaggtcaaaccgttaccttacaagctgccgtgagaggg
tcagaacccatttcggtcacatggatgaaaggacaagagatcctcaaagaagatggaaaa
atcaaaacgagcttttctaatggggtcgcgaccctgataatccctgatgttcagatcagt
catggtgacaagtacacgtgcctggctgaaaacgaggccggaagccaaacgtctgttggg
gaattaatagttaaagaacctgccaaaattgttgagagagccgaactggtccaggtgaca
gcaggagacccagccacgctggagtacacagtcacaggcaccccagaactcaagcccaag
tggtacaaagatggtaggcctttggttgccagtaaaaagtaccgaataagtttcaaaaac
aacgtcgcccaactcaagttttattcggccgagctgcatgatagcggccagtacacattt
gaggtttccaacgaggtgggcagcagctcctgcgagaccacgttcactgtactagatcgg
gacatcgccccgtttttcacgaagcccctgcgcaacgtggccagcgtcgtgggcagcgcc
tgcaggctggactgcaggatcgcgggctccctcccgatgcgggtggcctggttcaaggac
ggcagggagctggcttccggggacaagtacagggcggcgtttgtggaaggcacggcctcc
ttggagatccacggcgtggacctgagcgacgcgggcaccttcacttgccgagccaccaac
tccgtgggcagcaaagacagcagcggggccctggtggtgcaagagccacccagctttgtg
accaagccggcctcaaaggacgtcctgcccggctcggccgtgtgcctgaagagcaccttc
cggggctccggccctttcaccgtcaggtggctgaagggcggccgggagctggtctccggg
ggaagctgctatatcaccaaagaagcctcggaaagttccctggaactgtacgtggtcaag
acctccgattcgggcacgtacacctgtcaggtcggcaacgccgcgggcagcgtggagtgc
agtgcaaacttatttgtgaaagagccggccacgtttattgaaaagttagagccctcgcag
ctgctcaagaagggcgacagcacgcagctggcctgcaaggtggccggtacccccccgatt
aagataacgtggtttgccaacgacagagagcttaaggagggcggcaggcacaggatgtcc
tttgtggagtccaccgcggtcctgagccttacagaggtgaccaccgaggacagtggcgag
tacatgtgcgaggctcaaaacgaggccggcagcgaccactgcgggagcatcttaatagtc
aaagagtcgccttactttaccaaggagtttaagccagttgaagtgttgaaggagtatgac
gtcatgctgctggccgaggtggcgggcacgcctccctttgacatcacttggttcaaagac
aacacgacgctgagaagcggtaggaagtataagaccttcattcaggaccagctggttagc
ctgcagatcctcaagtttgtggccacagatgctggcgaataccagtgtcgggtgaccaac
gaggtgggcagcagcacctgcagtgccagggtgaccctaagagaaccgccaagcttcgta
aaaaagatcgagagtaccagctcccttcgaggaggcacggctgccttccaggccaccctg
aagggctccctgcccatcaccgtgacttggttgaaagacaacgatgaaatcactgaggat
gacaatataagaatgacctttgagaacaacgtggctagtctgtacctcagtggcatcgaa
gtcaagcacgatgggaaatacgtctgtcaggccaaaaatgatgcaggaatacagaggtgt
tcggcattgctctcagttaaagaacctgcaacaatcaccgaggaggctgtgtctatagat
gtcacccaaggggacccagccaccttgcaggttaaattttcagggactaaggagattaca
gcccgatggtttaaagatggccaagaactgaccctgggccaaaaatacaaaatcagtgtc
accgacacggtctctatactgaagattatttctacagaaaagagagatagtggagaatat
acttttgaggtccaaaatgatgttggaagaagcagctgcaaggctagcattaatgtatta
gatcttatcatacctccctcattcaccaagagactgaagaaaatggacagcattaaaggg
tcttctattgacttagaatgtatagtggctgggtcacatcccataagcatccagtggttc
aaagatgaccaagaaatatcagctagtgaaaaatacaaattctcttttcatgacaatact
gccttcttggaaatcagtcacctggaaggttcagacagtgggacgtacacttgttccgcc
actaataaggcaggacacaaccagtgcagtggccatctcacggtcaaagaacccccttac
ttcgtggaaaagccacagtcacaagatgtcaatcccagtacaagggttcagctaaaggca
cttgtgggtggcactgcacccatgacaataaagtggttcaaagataacaaagagttgcac
tcgggagcagctcgctccgtttggaaggatgacacctccaccatactggagctcttttca
gccaaatctgccgactctgggacctacatctgccaactaagcaatgatgtcggcacagca
accagtaaagccactctctttgtgaaagaacctcctcaatttattaagaagcccagcccg
gtattagtgctgagaaatggacaatctacgacattcgaatgccaaatcacaggcacccct
gaaatcagagtttcttggtatctggacgggaatgaaataacagccattaagaaacatggc
atttccttcatcgatggcctagccactttccaaatctctggtgccagggtagaaaatagt
gggacttacgtctgtgaagcccgtaatgacgcgggcacggcaagctgcagcattgaatta
aaagtgaaagagcctcccaccttcatcagggagctgaagcccgtggaggttgtaaaggat
agtgacgtgcagctggagtgtgaagttgcaggaacagctccatttgaagtcacgtggctg
aggaacaacaaggaaattcgaagcagcaaaaaatataccctcactgacagagtgtcagtg
tttagcctccatataaccaagtgtgacccttcagacactggtgactaccagtgcattgtg
tccaatgaaggtggcagctgctctagcagtactaaggtctcactgaaagaaccaccatca
ttcattaagaagatcgaaaacgtcacgaccgttctgaaaagttctggcaccttccagagc
accgtggcgggctcgccccccatttctatcacctggctaaaggatgaccacattcttgag
gaagatgataatgttcatatttcgtttgtgaacaacgtggccacacttcagatcagagct
gtggacaatggacacagcgggagatacacatgtcaagccaagaacgagtcaggagttgag
aggtgttatgctttcctcttagtacaagaacctgctcaaatcctggagaaagctaaatct
gttgatgttactgagaaagacccagtgactctggagtgtgttgtggctggaacaccagaa
ctcaaagtgaaatggcttaaagatggaaagcaaattgtgcccagtagatatttttcaatg
agttttgaaaataacgtggccagttttaggattcagtcagtaatgaagcaagacagtggt
cagtacactttcaaggtggaaaatgactttggaagcagtagctgtgatgcctacctgaga
gtgctagatcaagatattcctccatctttcaccaaaaaattgaccaaaatggataaaatt
ttgggctcttctattcgtatggagtgcaaggtttcaggctcactccctattagtgctcag
tggtttaaggatggaaaagaagtatctacaagtgcaaaatacagacttgtctgtcacgag
aacacggtgtcactggaagttaataatctggaattggaagacactgcgaattatacatgc
aaggtctccaatgtagccggggatgacgcatgcagtggcatcctaactgttaaagaacca
ccaagcttcctagtgaaacccgagcgacagcaagccataccggattccacagtagaattt
aaagcagtactgaaaggaacaccaccatttaaaataaagtggtttaaagatgatgtggaa
cttgcctctggacctacctgtttcattggcttggaagggtcaactagcttcttaaatctc
tattcagtggatgcttccaagactggacaatatacctgccaagttaccaatgacgttggt
agcgactcttgtactacaatgttgcttgtgacagaaccacccaagtttgtaaagaaatta
gaagcatctaaaatagtgaaagcaggtgactcagcacgacttgaatgcaagataactgga
tcccccgaaatcagagttgtgtggtacagaaatgaacatgaactccaagccagtgataaa
tacagaatgactttcattgactcagtggccgtcctacagatgaacaatctcggtactgag
gacagtggggatttcatttgtgaggctcagaatcctgctggcagcacaagctgcagtacc
aaggttatcgtaaaagaaccacccgtttttagcagcttccctcctgtagtagaaaccctt
aaaaatactgaagttagtcttgagtgtgaactttcgggaacaccaccatttgaggtgata
tggtacaaagacaagcggcaactccgaagtagcaagaaatacaagattgcatccaaaaac
ttccatgcaagtattcatattctcaatgttgaaacttcagacattggtgaataccactgc
aaagcacagaatgaagtgggaagtgatacttgcatttgtaccgtaaaattaaaagaacca
ccaagatttgtctccaaactgaacagcctcaccgttgtagctggcgagcccgctgagtta
caagcatacatagaaggagcccagcctatttttgttcagtggcttaaagagaaagaagaa
gtgatcagagaaagtgaaaacatcagaattacatttgtagaaaatgttgcaactctgcag
tttgcaaaagcagaaccagctaatgctgggaagtatatctgccaaatcaagaatgatggc
ggaatgagagagaacatggccacattgactgttttagagcctgcagtcattgttgagaaa
gcagggccaatgacagtgactgtgggagaaacgtgcaccctggagtgtaaggtggccggc
actcccgaactctcggttgaatggtacaaagatgggaagctgttgaccagcagccaaaaa
cacaaattcagcttctacaacaaaatctctaccttaaagatactctctgttgaaaggcaa
gacgcaggcacatacactttccaggttcaaaacaacgtcggaaaaagcagctgcacagct
gtggttgatgtttcagaccgaatggtccctccctctttcacacgaagactgagagatact
gttggggtgctgggtacttcttgcatcttggagtgcaaagtagctggatcgtcacctatc
tctgttgcctggtttcatgagaaaacgaagattgtcagcggagcaaagtaccagaccaca
ttctcagataacgtctgcacgttgcagctgaattctctggactcgtcggatatgggcagt
tacacatgcgtggctgctaatgccgctgggtctgatgaatgtcgtgcagcgttggctgta
caagaaccaccctcttttgtgaaggagcctgaacctctggaaatactaccaggcaaaaat
gtcactttcacaagcgtcattagaggaacccctccattcaaggtcggctggttcagaggt
gccagagaactcgtgagaggagaccagtgcaacatctactttgaagacactgtggcagag
ctggaattatttaatgttgacatctctcagagtggggaatacacttgtgtggtttctaac
aatgctggccaaacatcctgcactactcgtctctttgtgaaagaaccggctacatttgtg
aagaagctaagtgatcactccgtggaaccagggaagtccataattctggagagcacctac
accggaacacttccgattgcagttacctggaaaaaggatggtttcaacataagtcagtct
gaaagatgcagcatagtcacaacagagaaaacgtgcatcttagaaatcctgaatagcaca
aaaaaagatgcaggacagtactcctgtgaaattgaaaatgaggcaggcaaggatgtctgc
aaagctctggtatctacattagaaccaccttattttgttacggagctagaacctctggag
gcatcggttggagattcggtgtctttacaatgccaggttgctgggacaccagaaattaca
gtgtcttggtacaaaggagacaccaagttacggccaactcctgaatacaggacctatttt
acaaacaatgtggccacacttgtttttaataaagtgaatattaatgacagtggagagtac
acatgtaaagcagaaaacagtataggaactgctgcttcgaagactgtcttcagaattcaa
gagcgccaactcccaccttcctttgcaagacaattgaaagacatcgaacagacggttggg
ttgccagttacactcacttgtcgattaaatggctccgcacccatccaggtgtgctggtat
agagatggggtacttttacgagacgacgaaaatctacagatgtcatttgtagacaatgtg
gcaactttaaaaatcttgcaaactgacttgagtcactctggccagtactcctgctcagcc
tctaacccacttggaacagcatcttctagtgctagactggcagtgagagagcctaagaag
tctcccttctttgacatcaagcctgtatctatagatgtcattgctggggaaagtgctgac
tttgagtgtcatgtcactggtgctcaaccaatgcgaatcacttggtcaaaagataacaag
gagatacgtcctggaggaaattatactatcacatgtgtgggaaacactccccatttgaga
attcttaaagtaggcaaaggagactctggtcaatacacttgccaggcaaccaatgatgtt
ggcaaggacatgtgctcagctcaactcagtgtaaaagaacctcccaagttcgttaagaaa
ctagaagcttctcaagttgcaaagcatggagaatccatccagctggaatgtaaaataagt
ggttccccggaaatcaaagttcagtggttccgaaacgacagcgaacttcacgaaagctgg
aaatacaacatgtcattcattaattctgtggccttgcttaccatcaatgaagccagcgct
gaggacagcggagactatatctgtgaagctcataatggtgttggtgatgccagctgtagc
acagccctgaccgtgaaagcacctcctgttttcacccagaagccttctccagtaggagct
cttaaaggttctgacgtaatcttccaatgtgaaatttcgggaacccccccgtttgaggtg
gtgtgggttaaagaccgaaagcaagttcgaagcagcaagaaatttaaaatcacgtcaaaa
aattttgatacaagtcttcatatccttaatctcgaagcttccgatgtaggagagtatcac
tgcaaagccactaacgaggtgggaagcgacacgtgtgtttgctctgtcaagttcaaagaa
cctccacgatttgtgaaaaagctaagcgacacctcaacccttgttggggatgctgttgag
ttacgggctgtggtggaaggcttccagccaatttctgtggtctggctgaaagataaaggt
gaagtcatcagagagagtgaaaacactaggatttcgttcatcgataacatcgcaaccctc
caacttgggagcccaaaagcatctgattctggaaaatatgtgtgccagatcaagaacgat
gccgggacgcgagaatgttcggcggtcttgacagtcctagaaccagccagaatcgtagag
aagccagaacccatgacggtcactactgggaatccttttgcattagaatgtgtggtggct
ggaacaccagagctttcagtcaagtggttcaaagatgggagagaattgtctgcagacagc
aaacatcacattacgttcatcaacaaagtggcttcggttaaaatcccttgcgcagaaatg
agtgacaaggggttatacagcttcgaagtgaagaacagtgttggtaaaagcacctgctct
gtgtccgtccatgtctcggatcgagtcgtgcccccctccttcatccgcaagctgaaggac
accaacgccatcctgggggcctcggcggttctggagtgccgggtgtccggctcggccccc
atttcggtcggctggtttcaggacgggaatgaggtcgtcagcgggcctaaatgccagtcc
agcttttcggaaaacgtctgtactttgagcctgagcttactggagccctccgacacaggc
acatacacgtgcgtggccgccaacgtggccggttctgacgagtgctcggcactgctgacc
gtgcaagaacccccgtccttcgaacaggtccccgactccgtggaagtgctgcctggaata
agcctcatattcacctgtgtcatcagaggcacccctccattcaaggtcaagtggtttaaa
ggcagcagggaactggtgtcgggggagtcctgcaccatctccctggaggatgacgtgacc
gagctggagctgctggaggtggagccgtcgcagagcggggactactcctgcctcgtcacc
aatgaggcgggcagtgcctcctgtaccgcgcacctttttgtgaaagaaccagccaccttt
gtgaaaaggttggctgacttcagcgtggagacgggaagccccatagtgctcgaggccacc
tattcgggcacacctcccatctccgtgagctggatgaagaatgagtccccgctgtcccag
tcacagaattgcagcattaccacgacggaaaaatccacgatactggaaattactgagagc
accatagaggattatgcacagtacagttgcctgatagaaaatgaggccggtcaagacatt
tgtgacgcgctggtgtctgtcttagaaccgccttatttcattgagcctctgcaacacgta
gaagcagtcattggagaacccacgactttacaatgtaaagtagatggaaccccagaaatt
agaattgcttggtataaagaacacacaaagctgcgctcagctcctgcgtacaaaatgcaa
tttaaaaataacgtcgcctccttagttatcaacaaagtggatcacagtgacataggagag
tacacctgcaaggcagagaacagtgtgggggcagtcgcttcttcggccgtgctcattatc
aaagagcgcaaacttccaccttcctttgcaagaaagctgaaggatgttcacgagaccctt
ggcttcccagtcgcatttgaatgtcgcatcaatggctcagaacctcttcaagtgtcttgg
tacaaggatggggtacttttgaaagacgatgctaatttgcaaacctcttttgttcataac
gtagcaacccttcagattttgcaaactgaccagagccacgttggtcagtacaattgttca
gcttccaatcctcttggaactgcttcatctagcgccaagctcattctctcagagcatgaa
gtgcctcctttctttgatctaaagcccgtatcagtagatcttgctcttggagaaagtggt
tctcttaaatgtcatgtaactggaactgcacccatcaaaatcacttgggccaaagataac
cgagagattcgccccggaggcaactacaagatgactttggttgaaaatactgccactctg
accgttctcaaagtaagcaaaggcgatgctgggcagtacacctgctacgcaagcaacgtc
gctggaaaagactcttgttctgctcacctgggtgtacaagaaccacccaggttcattaag
aagctagaaccttcaagaattgtgaaacaggatgaatacacaagatacgaatgcaaaatc
ggagggtctccagaaatcaaggttttgtggtacaaagatgagactgaaattcaagagagc
agtaaattcagaatgtcattccttgactcggtggcggtgttggaaatgcacaacctcagt
gtcgaggacagcggagactacacgtgtgaggcccgcaacgcagcaggcagtgcgagcagc
agcacttccttaaaagttaaagaaccacccattttccgcaaaaagcctcatcctgttgag
acactgaagggagctgatgttcatcttgaatgtgagcttcaggggactcctccttttcaa
gtttcttggcataaagataagagagaacttaggagtggcaagaagtacaagataatgtcc
gagaacttcctgacgagcattcacatcctgggtgtcgatgctgcagacataggggagtac
cagtgcaaagccaccaatgatgtgggcagcgacacttgtgttgcttctatcactctgaaa
gcaccaccaaggtttgtgaagaagctcagcgatatttctaccatcgttggtgaagaagtt
cagctgcagaccactatcgaagggcctgagccaatatcagtggtgtggttcaaagataag
ggggaaattgttagagagagtgacaacatatgggtgtcttattcagaaaatgttgcaacc
ctgcagtttgcaagagcagaaacagccaacgccggaaagtacacctgtcagatcaaaaac
gacgctggaatgcaagagtgcttcgccacgctctccgttcttgaacctgcggcaattgtg
gaaaagccagaatccataagagttaccacaggagatacctgtaccttggaatgcacagtc
actggcacacctgaactcagtactaagtggtttaaggatggaaaagagctgacgagtgac
agcaaatacaaaataagtttcttcaacaaagtatctggccttaagattatcaacgtggca
cccagtgacagtggggtatacagtttcgaggtgcaaaaccctgttggcaaagacagctgt
acagcctcagtacaagtttcagaccgaattgttcctccttcattcacgagaaaattgaaa
gagacgcatggtctgtctggttcctcagtggtaatggagtgcaaagtctatgggtcaccc
ccaatctctgtctcctggttccacgaaggaaacgaggtcagcagtggaaggaaataccag
accaccctgacagataacacttgtgctttaactgtgaacatgctagaagagtccgatgcc
ggcgactacacgtgtatagctactaatgtagccggttctgatgaatgcagtgctcctctg
actgtgagagaaccaccatcttttgttcagaaacctgaggccatggatgtcttaaccgga
gccaatgtaactttcacaagcatcataaaaggaacacctcctttcactgtcagctggttc
aagggtagcagtgaactagccccaggcgacaggtgtaacgtatctctggaggattgcgtt
gctgagctggagttgtttggtgtagacacaacacaaagcggagactatacctgcatagtt
agtaatgaagctggcaaagcttcctgtacaacacacctctatgtaaaagccccagccaaa
tttgtgaagaggctcaatgattacagcatagagaaaggaaagcccctgattctcgagggc
acctacactggaactcctcccatttcagttacatggaagaaaaatggcataaacataact
ccttcccagaggtgtaatataaccacaactgaaaaatctgcaatcctggaaattccaagt
agcacggtagaggatgcgggacaatacaattgctacattgaaaatgcttctggaaaagat
tcctgctcggcacaaatactgatactagaaccaccgtattttgtcaagcagctggagcct
gttaaagtgaccgttggagactctgcctctttgcaatgccaaattgctgggacccctgaa
attggggtgtcctggtacaaaggagacacaaaattaagacctactgccacctacaaaatg
cattttaggaacaacgtggctacactggttttcaaccaggttgatagtaatgacagcgga
gaatatatctgcagagctgaaaacagtgtgggggaagtttcttcatcaactttccttagt
gtgcaagagcaaaaacttccaccatcattttctcgtcaactgcgagatgttcaagaaacg
gttggactgcccgttgtctttgaatgtaccataaatggatcagagcctatctcagtgtct
tggtacaaagacggcaagccattgaaagatggcccaaatgtacagacgtcatttttagat
aacgtggccactctcaatatttttaaaacagatcggagccttgcaggccagtattcttgc
acagctacgaatcctatagggtctgcttcctccagcgccagactcatcctcacagagggg
aagaacccgcccttctttgacatccccgtggcccctgtggatgctgtggtcggggagagt
gcagacttcgagtgccacgttactgggacacaaccaataaaggtcacctgggccaaggac
aacagagagatacgaagtggcggaaactaccagattagttacctggaaaacagcgcccac
ctgacgatactgaaagtagacaagggagactctggacagtatacctgctatgctgtgaat
gaagtgggaaaggactcctgcacagctcaacttaatataaaagaacggctaattccacca
agtttcactaaaaaactctccgagacagttgaagaaacagaagggaattcgttccgcctt
gagggccgtgttgccggttctcagcctataacggttgcatggtacaaaaataatatagag
attcacccaacttctaactgcgaaattacattcaagaacaacaccctcctgctgcacgtc
aagaaggcaggcatgggcgacgctggcttgtacacatgcaaagtgtccaatgacgcgggc
tctgctctgtgtacatcttcaattgtcatcaaagaacctaagaaggcgcctgtgtttgat
cagcacctcactccagtaacagtaagtgaaggagaatttgtgcagctcagctgccacgtg
cagggatcggagcccatcaggatccagtggttgaaggctggaagggaaataaagccttca
gacaggtgcagcttcagctttgccaacgggaccgccgtgctggaactgaaggacgtggct
aaagccgattcgggagattacgtgtgcaaagcttcaaatgcggctggaagtgacacttca
aaatcaaaagtgaccattaaagacaaaccagccgcagtcccagcagctaagaaagcagca
gtcgacgggagactcttcttcgtgtcagaacctcagagtatcagagtcgtagaaaaaacc
actgcaacattcattgcaaaagttggaggtgatccaatcccaaatgttaaatggacaaaa
gggaaatggaggcaactgaaccaggggggtcgcattcatatccaccagaaaggcgatgaa
gcaaagctggagattagagacaccacaaaaaccgattctggattgtatcggtgtgtcgca
tttaataaacacggtgaaattgaaagtaatgttaacctgcaggtggatgaaaggaagaaa
caagagaagattgaaggagatcttagagcaatgctgaaaaaaactccagtcttaaagaag
ggaactggagaagaggaggaaatcgatattatggaacttctcaaaaatgttgatcctaaa
gaatatgaaaaatatgcccgcatgtatggaatcactgacttccgaggtcttcttcaagcg
tttgaaatgttaaagcaaagtcaagaagaggagacacatagattggaaattgaggaaata
gagaagtcagagaaggacgaaaaggaatttgaggaacttgtatcatttattcagcaaagg
ctgtcacagacagagcctgtcactctgatcaaggatattgagaatcagacagttttgaaa
gatgacgaagccgtgttcgaaattgacatcaagatcaattatccagagatcaagctttca
tggtacaaagggactgaaaaactggaacccagtgataaatttgaaataagtattgatggt
gaccgacacacactcagagtcaaagactgtcaactcaaagatcagggcaattatagattg
gtgtgtggtccccacatcgctagtgccaaactaaccgtgatcgagcctgcttgggaacgg
catcttcaggatgtgactttgaaagaaggccagacgtgcaccatgacctgccagttttca
gtgccaaacgtaaaatcttcatggttcagaaatggcagactcctgaagccccagggcagg
catcagacagcagtggagcacaaggtccacaaactgaccatcgcagatgttcgagcagaa
gaccagggacggtacacctgcaaatatgaagacctggagacgtcggcagagctcagaatt
gaagctgaaccaattcagtttacgaagcgcatacagaacatcgtggtgagtgagcatcag
tctgccaccttcgaatgcgaagtgtcttttgatgatgccatagtgacatggtacaaaggc
ccaacagaactgactgaaagccagaagtacaactttaggaatgatggtcgctgccattac
atgaccatccacaatgtgaccccagatgacgaaggtgtctactcagtaattgctcgactg
gaaccaagaggtgaagcaagaagcacagcagagctgtacttaacaactaaagaaatcaag
cttgagatgacgcctcccgatattcctgattccagagtcccgatcccaaccatgcctatc
cgagcagtacctccggaagaaatccctgcgatggttgttcctcctattcctctgttgctg
ccatcacctgaagaaaagaaaccaccagcaaaacgcattgaagtgaccaaaaaagctgtg
aaaaaagatgccaaaaaagttgttgcgaagcccaaagaagagccacctcaagaggttgcc
aagaagcccctgcgtccaactgccttgattccagctgaagctcctgaaattatcgatata
tcctccaaggctgaagaagtaaaaataacgacaataaccagaaagaaagaggttcaaaaa
gaaaaagaagctgtgtatgagaaaaagcgtgctgtctacgaggaaaagaaacttttcatc
gaatctttggaagaaccttatgatgaactggaagtggaacagtacgcggagccattcgaa
gaaccttactatgaagagccggatgaggactacgaggagaccaaggtcgaagctaaaagg
gaagtccacgaggaatgggaggaagatttcgaggaaggccaggagtactatgaaagggaa
gaaggttatgatgaaggggaggaagagtgggaagaaacttacaaagagagagaagtcatc
caagtgcaaaaggaggtttacgaagaatcacatgagagaagaattccagccaaagtgcct
gaaaagaaagcagtgccacctccaaaagttgtaaagaagccagtagttgaaaaaattgaa
aagacctctcgaagaatggaggaagagaaagttcaagtcaccaaagtacccgaagtttca
aagaagatggttccacaaaaaccttctcggactccagtgcaggaagaagttattgaagtg
aaagtaccagccgtgcatacaaagaagatggttatttcagaagagaagatgttctttgct
tctcacacagaggaggaggtgtcagtcacagtccccgaggtacaaaagaaaactgttacc
gaagagaaaattcatgttgctgtctccaaaaagactgagcctccacctaaagtccctgag
ccacctaagaaaccggtccctgaagaagtggttgctgttcccattcctaaaaaggtggag
cccccaccagccaaagttcctgaagttcccaagaaacctgtgccagaggagaaaaagcct
gttcctgtccccaaaaaggaacctgctgctcccccaaaagtcccagaagtgccaaagaaa
cctgtccctgaagaaaagattcctgttcctgttgcaaagaaaaaggaagctccaccagct
aaagttcctgaagtacagaagagggttgtcacagaagaaaaaataaccattgtcactgaa
agagaggaatctccaccaccagcagtgccagaaataccaaagaagaaagtcccagaagaa
aaaagacccgttcctcatatagaggaagaagctccaccaccaaaagttctgcgtaagaaa
cccgtccctgaagagaaagttcctgtaccagttcctgtcgctaagaaagctcctcctccc
cgagctgaagtttctaagaaaactgtggtagaagaaaaaagattcgctgccgaagaaaaa
ctgtctgtggcggttcctcagagagtggaactcatgcgacacgaagaggaggagtggagt
tattcagaagaagaggaaagagtgtccttttcagtctatagagaagaggaaagagaggag
gaggaagaagaagtagagattactgaatatgaagtgatggaagagccggaggaatatgtt
gtggaagaaaagacgcactttatttctaagagagtggaagctgaaccagctgaagtgctt
gagaagcatgagaagaagattgtaatgaaaccgaaaattcctgctaaaatagaggagccc
ccaccagccaaagttcctgaagcacctaagaaaattgtgccagaaaagaaagtccctgct
gcagttcccaaaaaggaaaaggtgccaccagtgccagaagagccaaagaagccagttcca
gaaaaaagggttcctccaaaagtggttaaggaagaagagcctccccccaccaaagtggct
gagaggcacatgcaaattacccaagaagaaaaagttcacgttgctgtaactaaaaaagag
gagcctccgagagcaagagtgcctgaagaacccaagagagctgttccagaagaaaaaatt
cctaaacccaaacctaagagagaggaagaaccaccagcaaaagtcactgaaatcagaaaa
agagctgttaaagaagaaaaggtatccattgaagttccaaaaagaaaagctcctcccgtg
aaagaagtaactgtaactgaagagaaagaatggtcttacgtccatgaagaagaaactgtt
tcagtagaacgggaagaggaatatgatgaaatcgaggaatatgaatataaagaatctgag
gagtatgaaccaacagaagaatatgaccaatatgaagaatatgaggaacgtgaatttgaa
cattatgaagagtataaagagcatgaagaatatgtcacagaagaacccaagaagcctctc
ccagtaaagcctgtccaagaagaaccggttcccagaaagccaaaggctccaccagctaaa
gtgccgaagaaagtcgtccctgaagaaaaagtcccagtgcccattcccaagaaactcaaa
cctccaccacccaaagtgactgaagaatcaaagaaacttgttgaggaaaaaatacacatt
tcaattaccaaacgtgaaaaagagcaggtggctgagccagctgttaaagtgcccgtgatg
cccaagagagttgtcacagaagaaaaagtgcttgttcctaaaaaagaagtaacagcacct
gttacagtgccagaagtaccaaaaagacaagaaccagaagagattgtctatgaagaggaa
gttgtaacccaagtagaagaatattttgaagaagaagaagaagaagaagaatacattcat
gaagaagaggaattcataactgaagaagaagtcgtaccagtgataccagtcaaagtgccc
gagatacccaagaaacctgtaccagaagagaagaaacctgttcctgttcccaaaaagaag
gaagccccaccagcaaaagtgcctgaggttcctaagaagccagaggagaaagttcctgtg
cccgttcctaaaaaagagaagcctccaccagctaaagttcctgaagtacccaagaaacct
gtaccagaggagaaagtaccagtaccggttcctaaaaaggtggaagcaccacccgccaaa
gtgccagaagtgcccaagaagcctgtgcctgagaagaaagtgccagttcctgttcctaag
aaagtagaggctccacctgcaaaagtgccagaggtgcccaagaaggtcatcccagaggaa
aagaaaccaacacctgttccgaaaaaagcagaagctccaccacccaaagtgccgaagaaa
cgcgagccagttccagttcctgtagctctacttcgggaagaagaagttccatttgaagaa
gaaattgctcctgaagaggaagttctacctgaggaggaggaagttctacctgaggaggag
gaagttccacctgaggaggaggaagttccacctgaggaggaggaagttctacctgaggag
gaggaagttccacctgaggaggaagaagttccacctgaggaggaggaagttccacctgag
gaggaggaagttcctcctgaagaagaagttgaacctgaagaagagcaagtccttccagaa
atcaaacctaagaagccagtacctgcacgagtgcctgaagtgccaaagaaacctgtacca
cagaagaaagtccctgtgccggctcctaaaaaagtggaacctccaccatccaaagtgcct
gaggttaagaagaaagtgccagagaagaaagtgatcattcataagaaagaggaggcgcct
cctgccacagtgcctgtggtgcttaagaaacctgaaccagaaaagaaagtgcctcctcct
ggtcttaagaaagcagtgcctcctcctgccaaagttcctgaggtacctaagagagtggaa
gaaacacgaatcattctccctgaagaagaggaagttccactggttgaagtgtatgaggag
cccgaagagcctattccagaagaagagatccctgaagaaccacctagcatagaagagttt
gaggaggttgttccacctagagtgcctgaagtggttaagaaagcagtacctgaagtacct
actcctgttcctaaaaaagtggaggcaccaccagctaaagtgccaaagaaggttcccgag
gaaaaagtacctgttcctgttcagaaaaaagagccacctccagccaaagtgccagaaaag
aaagtcccagaaaagaaaatcgcagaaaagaaagtccctgtgcctaaaaaggaagctgtt
cccccagctaaagggaggactgtctatgaagaaaaagtatcagttgccttccacaaagag
gaggtagtaagagaaagaacagaattagaagtagtggaaacaccagtggaagttcttgag
gaagaagagttccacgaagttcaagaatattttgaagaagaagagttccatgaagtagaa
gaattcatcagagtcgaaaaacctagaatggaagaagtacacagagctgaagaggtccat
agggtaatagaatttttagagacagaagaagtggaagtatatgaaaaacccaaagctcca
cctaaagggcctgaaatatctgagaaagtcatccctccaaaaaaaccacccactaaagtt
gttcctcgaaaagagccaccagctaaagtacctgaagcgcccaagaaaattgtggtagaa
gaaaaagtacgtgttcctgaagagcccacatttccaccagctaaagtgcccgaggctccc
aaagaagttgtccctgaaaagaaagtgcgtgtgccgcctcctaaaaagccagaagtccca
tctgttacagtgcccgaggctcccgaagaagttgtccctgaaaagaaagtgcgtgtgccg
cctcctaaaaagccagaagttccacctgttacagtgcccgaggctcccaaagaagttgtc
cctgaaaagaaagtgcatgtggcacctcctaaaaagccagaagtcccacctgttaaagtg
cctgaggctcccaaagaagttgtccctgaaaagaaagtacgtgtgccgcctcctaaaaag
ccagaagtcccacctgttacagtgcccgaggctcccaaagaagttgtccctgaaaagaaa
gtgcctgcggcgcctcccaaaaagcctgaagtcccaccagccaaagtgccggaggtgccc
aaggcagctgttccagaaaagaaggtgcctgaagtgattcctcccaaaccagaaagtcct
ccccctccagtgcatgaggagcctgaagaagttgcctgggaagagcccccggccgaagct
gtggaagagccagagcctgctcctcctccaaaagtggcggtgccacccaagaaacctgtc
ccagaaaagaaaccacctgctattgttgccaaaaagcctgaaccaccaccagtgaaagtg
cctgaggtacccaaggaagttgtccctgaaaagaaggtgcctccagtggttcccaaaaaa
ccagaagtcccacctgctaaagtgcctgaagttccaaaagaagttgttgcagagaagaaa
gtaacggtgcccaagaagcccgaagtcccgccacctaaagtgccagaggtgccaaagaaa
cctgtctttgaagaggaaccagccattcctgttcccgagaaagcagagtctcctcctcca
gaagtatatgaagaacctgaggaaattgctcctgaagaggaagagccagttcctgtcgca
gaggaggaggaaccagaagccccaccaccagcagtgcctgaagaacccaagaagattgtt
ccagaaaagaaagttcctgttatcaagaagccagaagctccacctcctaaagaacctgaa
cctgaacctgaaaagaaggttgttgagaaaccaaaactcaaaccaaagcctgccgcacct
cctccggctccaccgaaggaagatgtgaaggagaaaatgttccaacttaaagctgtttca
aagaagaaagttcctgaaaaacctgaagtcccagaaaaagtggagcttaagcctctgaaa
gtgcctggagctgaaaagaaagttcgcaaattacttcctgaacctaaacctcaaccaaag
gaagaagttgttctcaaaagcgttctaagaaagagacctgaagaagaagaacctaaagta
gaacctaaaaaactagaaaaaattaaaaaaccagtaccagagccacctccaaaagctgtt
gaagaggctgaagtacctccagctccggttacaaaaagggaaaggaaaattcctgaacca
gtaaaagtgcctgaaattaagccagcaatacctctccctggacctgaacctaaaccaaag
cctgaaccagaagtgaaagtaatcaaaccacctcctgtggagcctgcaccgacccccatc
gccgccccggtaacggtgcctgtggttggaaagaaagcagaagccaaagcacctaaagag
gaggctgccaagccgaaaggtcccatcaaaggtatccccaaaaagactccttcaccaata
gaagttgaaaggaaaaagttaagaccaggaagtggtggagagaaacctcccgatgaggcc
cctttcacctaccagctaaaggctgtaccactgaagtttgtgaaagagatcaaagacatt
gtcttgaccgaagcagagtccgttgggtcttctgcgatctttgaatgtctggtctccccc
tccactgcaattacaagctggatgaaagacggtagcaatatccgtgagagcccaaagcac
agattcatcgcagatggtaaagacagaaagctgcatatcatggatgtccagctttctgat
gccggcgaatacacctgtgtcttacgcttgggaaataaggagaagacctccacggccaaa
cttgttgtggaagaacttcctgtgcgtttcgtaaagacactcgaggaggaagtcaccgtg
gtcaaaggacagccgctgtacttgagctgtgagctaaacaaggagcgcgacgtggtctgg
aggaaggatgggaagattgtggtggagaaacctggcaaaattgtgcccggtgtaatcggc
ttgttgcgagccctgaccatcaacgatgcagatgaccaggatgctggaacatacacagtt
accgtggaaaacgccaacaacctggaatgttcatcctgcgtcaaagtagtagaagtcatc
agagactggctggtgaagcctatacgggatcagcacgtgaaaccaaagggcacggctgtt
tttacctgtgtgatagcaaaggatactccaaacatcaaatggttcaaaggatatgatgaa
atccccctggaacctaatgataagactgagatagtaagagaaggaaatcatctcttcctc
aaagtcaagaatgccacaccggaagatattgatgaatacgcggtggaaattgaagggaaa
agataccccgcaaagctgacactaggagagcgtgaagttgaattgcttaagccaatcgag
gatgttaccatttatgagaaggaaagcgcaagctttgatgcagaaatctcagaggcagac
attcctggacagtggaaactgaagggagaacttcttcggccctcacctacctgtgaaatc
aaagcagaaggtggaaaacgcttcttgactttgcacaaagtcaaactggaccaagccggg
gaagtcctttaccaggcgcttaatgcatttacaactgccatcctgacagtaaaagaaatc
gaacttgactttgctgtgcccctgaaggatgtcactgttccagaaaggcgacaagctcga
tttgaatgtgtcctcactcgagaagcaaatgtgatatggtcgaaaggacctgatataatc
aaggcatctgacaagtttgatatcattgctgatggaaagaaacacattctcgttatcaat
gattctcattttgatgacgaaggggtctatactgctgaagtagagggcaagaagagctca
gcacgattatttgttacaggtataaggttgaagttcatatcgcctctcgaagaccaaacc
gtgaaagaaggccaaacagcaacttttgtttgtgagctttctcatgaaaaaatgcatgtc
gtctggttcaaaaatgatgccaaactccacacaagcagaaccgtactcatctcatctgag
ggcaagactcacaaactggaaataagagaagtgaccctggatgatatatcccagataaga
gctcaagttaaggacctgagctccaccgcaaacctgaaggtcttagaggctgatccctac
ttcactgtgaaattacacgacaaaactggagttgagaaggatgagattattctgaagtgc
gaagtgagcaaagatgtcccagtgaaatggttcaaggatggtgaagagattgtaccttca
gccaaatactctatcaagacggatggcctgcgccgcatcctaaaaatcaaaaaggcagaa
cttaaagataaaggcgaatatatgtgtgactgtggcaccgaccagacaaaagcaaacgtt
actgttgaggctcgactaataaaagtggagaaacctctgtacggagtagaattgtttgtc
ggggaaacagctcgctttgaaatagaactttctgaaccagacgttcacggccagtggaag
ttaaaaggagagcctttaactgcttcccctgactgtgaaatcatcgaagatgggaagaaa
catattctggtcctttataactgccagctggatatgacaggggaggtttccttccaggcc
gccaacgctaaatctgcagccaatctgaaagtgaaagaactgccactcatcttcatcaca
cctctcagtgatgttaaagtctttgagaaagatgaggctaagtttgagtgtgaagtgtcc
agggagcccaaaacgttccgttggctgaaaggaacccaggaaatcacaggtgatgataaa
gttgagcttataaaggatggcactaagcattccttggtgatcaagtcagctgcttttgaa
gatgaaggaaaatacatatttgaagccgaagacaaacacacaagtggcaaactgatcatt
gaaggaatccgactcaaattcctcactccactcaaggatgtaacagccaaagagagggaa
agtgctgtgttcacggtggagctgtcccacgataacatccgagttaagtggttcaagaac
gaccagcgcctgcacaccagcaggtctgtctggatggatgatgaagggaagactcattcc
atcacgttcagagacctctccattgatgacacctctcaaattaaagtagaagccatgggg
ctaagttcagaagctaaactcactgtgcttgagggagatccatacttcaccggaaagctt
caggattacacgggcgtagagaaagatgaagtgatcctacagtgtgaaattagcaaagca
gatgccccggtgaaatggtttaaggacggggaggaaataaaaccatctaaaaatgttgtt
attaaggcggatggcaagaagcgcatactcatcctaaagaaagccttgaaatcagacatt
ggacagtatacctgtgactgtgggacagacaagacctcagggaagcttaacattgaagat
cgggaaatcaaactggtccggcccctgcatagtgtggaggtgatggagactgagacggcc
cgctttgaaaccgaaatctccgaagaggatatccatgccaactggaaactcaagggagag
gcactactccaaacacctgattgtgagatcaaggaagaaggcaaaatgcacttccttatt
ttgcacaactgccgcctggaccagaccggcggggtggatttccaggctgccaacgtgaaa
tctagcgctcacctccgggtgaaaccacgagtaattggtctcctgaggcctctgaaggat
gtcacggtgaccgcaggggagacagccaccttcgactgcgagctctcctacgaggatatc
ccggtggaatggtatctcaaagggaagaaactcgagcccagcgagaaggtggtcccacgt
tcagaaggaaaagttcatacccttacactgagggatgtaaaattagaagatgctggagaa
gtccaactacgagcaaaagatttcaaaactcatgccaacctctttgtgaaagaacccccc
gttgagttcactaagccccttgaggaccagacggtcgaagaagaagccactgcagtattg
gagtgtgaagtatccagagaaaatgctaaggtgaaatggttcaaaaatgggacagaaatt
ctcaaaagcaagaagtatgaaattgttgctgatggcagggtcagaaaacttattatacac
ggctgtactccagaggatattaaaacatacacttgtgatgctaaggattttaagacttcc
tgtaacctgaacgtcgtgcctcctcatgtggaattcttaagaccactcactgatcttcaa
gttaaagaaaaagaaatggctcggtttgagtgtgaaatttcccgagaaaatgctaaggtc
cagtggtttaaagatggagccgaaattaaaaagggcaaaaaatatgacatcatctctaag
ggagcagtacgcattcttgtcatcaacaaatgtctcctggatgatgaagcagaatattcc
tgtgaagtaaagacagcaagaacttctggcatgctcaccgtcctggcagaagaagctgtc
tttacaaaaaatcttggcaacattgaagttagtgaaacagacaccataaaactggtttgt
gaagtctccaagcctggagcagaagtgacttggtacaaaggagatgaggagataatcgaa
acaggaagatatgaaatacttaccgatgggcgaaagagaatcctgatcattcagaatgct
catcttgaggatgctggcaactacaactgccgactcccaagttctcgaactgatggcaaa
gtcaaagtacatgaacttgctgccgaatttatctcaaagcctcaaaaccttgaagtactt
gaaggagaaaaggctgaattcgtctgctccatatcaaaggagaacttcgaagtccagtgg
aagagggatgataagacacttgaacctggagacaaatatgacattattgctgatggcaaa
aagaggatcttggtcgtgaaagatgccacattacaagatatgggcacctatgtagtcatg
gttggggccgccagagcagcagcacacttgacagtgattgaaaaactcaggatcatagtt
cctcttaaggacacccgtgtaaaggaacaacaagaagtcgttttcaactgcgaagtcaat
acggaaggtgcaaaagccaaatggttcagaaatgaagaggccatatttgatagttcaaaa
tacattattctccaaaaagacctggtctacactctaagaattagagatgctcggttagat
gatcaagccaattatagtgtgtctctgaccaatcacagaggtgaaaatgttaagagcgct
gctaatctaatagtagaagaggaagaccttaggattatcgagcctcttaaagatattgaa
acaatggagaagaaaactgtcaccttctggtgcaaggtcaatcgtctcaatgtaacactg
aagtggacccgaaatggagaagaggtggcctttgacaaccgtgtcacatacagaattgat
aaatacaagcactctctcattattaaagactgtggcttcccggatgagggtgaatacgtt
gtcactgctggacaagataaatctgttgctgagcttctgatcatagaagcccctacggaa
ttcatcgaacacttagaagaccagacagtcactgagttcgatgatgcggtcttctcctgt
cagctctccagagagaaggctaatgtgaaatggtacagaaatgggagagaaatcaaagaa
ggcaaaaaatacaaatttgaaaaagaaggaagtacacatagactcattataaaagactgc
cgcctggatgatgaatgtgaatatgcttgtggagtagaagacagaaaatctcgagccaga
cttttcgtggaagaaatccccgttgagatcatcaggcctccccaagatattctggaagcc
cctggtaccgacgttgtctttttggctgagctcaacaaagataaggtggaagttcagtgg
ctaagaaataacatggtggttgttcagggcgacaaacaccagatgatgagtgaaggaaag
atccacaggctacagatttgtaatattcaacctcgtgaccagggtgaatatagatttatt
gccaaagacaaagaagccagagctaagcttgaactcgcagctgcacctaaaatcaagaca
ggtgatcaagatcttgtggttgatgttggccagcctctgacgatggtggtgccctatgac
gcctaccctaaagcagaagctgagtggtttaaagaaaatgaacctctgtcttcaaaaacc
gttgatactacagctgaacaaacttctttcagaattttagaagctaagaaaggagacaaa
gggaggtataaaattgtgcttcagaacaaacatggaaaagcagaagcgttcatcaattta
agagttattgatgtccctgggcctgtacgtaacttagaagtgacagaaacatttgatggt
gaagtaagcctcgggtgggaagaaccattaacagatggtgggagcaaaatcatcggttat
gtcgttgaaagacgtgacatcaaaaggaagacgtgggttctggccacggaccgtgcagac
agttgtgagtttactgtcactggacttcaaaaaggcggagtcgagtacctcttccgggtc
agtgcgaggaacagagtcggcactggtgagccagtagagactgacaacccggtggaagca
aggagtaaatatgatgtcccaggccctcctttgaacgtcgccatcactgatataaacaga
tttggggtctccctgacatgggagccaccagagtatgatggaggagctgagatcacaaac
tatgttatcgaattaagagataagacttctatccgatgggacactgctatgacagtgaga
gctgaagacctctctgcaactgtgactgatgtggtggaaggacaagagtatagtttccgg
gtcagagcccaaaaccgaattggagttggaaaaccaagtgcagccacaccctttgtcaaa
gttgctgatccaattgagagaccaagtcctcctgtgaacctaagttcttcagatcagact
cagtcatcagttcagctcacgtgggagcctcctctgaaagatggaggaagcccaatattg
ggatatataattgaacgatgtgaagaagggaaagataattggattcgttgcaataagaaa
ctagtccctgaactgacctacaaggttactggattacaaaaaggaaacaaatatttatat
cgagtatctgcagaaaatgaagctggtgtttcagatccatctgaaattcttggtcctctg
actgctgatgatgcgtttgttgaaccaacaatggacttaagtgcatttaaagatggtctg
gaagttattgtcccgaatccgatcaagatcctggttccaagtacaggctatccaaggcca
catgcaacctggtcttttggagataaagtactagaagcaggggaccgtgtgaaaatgaaa
accatatctgcctacgctgaacttgtcatttctccaagtgaacgtccagataagggcatt
tatacactaaaattagaaaatcctgtgaaagcaatttctggagagattgacgtcaatgta
attgctcgcccaagtgcacccaaagaactaaaatttggtgagataaccagagactcggta
catttgacttgggaaccaccagatgatgatggaggaagtccattaactggatatgttgtt
caaaagcgagaagtcagccggaaaacatggactaaagttatagacttggtgactgaccta
gaattcacagttcctgatcttgttcaaggaaaagagtatttatttaaagtctgtgcttgt
aacaagtgtggtcctggagaacctgcatatgttgatgaacctgtaaatatgtcagctcct
gcaaccgtacctgacccaccagagaatgttaaatggagagatcgaacagccaacagtatc
ttcctaacatgggatccacctaaatatgatggtggttcacgcatcaaaggctatatagtt
gaaaaatgtccacgtggttctgatcgatgggttgcctgtggagaaccagttgcagacaca
aaaatggaagtgacaggtcttgaagaaggccaatggtatgcctaccgtgtgaaggccttg
aaccggcaaggtgctagcaaaccaagcaaacccacggatgaaatccaagctgtggataca
caggaggctccagaaattttcctcgatgtgaagctccttgctggtctcactgtaaaagca
ggaactaagatcgaacttcctgccactgtaactggaaaacccgaacctacaataacttgg
acaaaggctgatatgcttctgaagcaggacaaaagaatcaccattgaaaacgttcctaaa
aaatccacagtgaccatcctcgatagtaagagaagcgacactggcacatacatcatcgag
gccgtaaatgtctgtggtcgggccactgctgtggtcgaagtgaatgtcttagataaaccc
ggaccaccagctgcttttgatgtcacagaagtgaccaatgaatcatgccttctaacatgg
aacccaccacgtgatgatggtggatctaaaatcacaaactatgttgtggagagacgggca
actgacagtgaagtgtggcacaagctctcatcaactgtcaaggatacaaactacaaggca
accaaattaacacccaataaagaatacatcttcagagtcgctgcagaaaacatgtatggt
gttggtgaaccggttcaggcctctccaataacagctaaatatcagtttgatccacctgga
cctccaactcgcctagaaccttctgatatcactaaagatgcagttactctcacatggtgt
gagccagacgatgatggtggcagcccaatcactggatactgggtggaaagattagatcct
gacactgataaatgggtcaggtgcaataagatgcccgtgaaggatacaacatatagagtg
aaaggtctcaccaataagaaaaaatacagattccgtgtgttggctgaaaatctcgctgga
cctggaaaaccaagtagatcaactgaaccaatcttaataaaggatcccatagatcctcca
tggcctcctggaaaaccaactgtgaaagatgtaggcaaaacatcactgatgttgaattgg
acaaagccagaacatgacggaggggcaaagattgagtcttatatcattgaaatgctaaag
accggaacagaggactgggtccgagtggctgaaggtgttcccaccactcagcatttgctt
actggtctcatggaagggcaagaatactccttccgagttagagctgtgaacaaggctggg
gaaagcgagcccagcgaacccagcgaccctgtgctttgtagggaaaaactatatcctcca
tcaccacctcgctggcttgaagttattaatatcacaaaaaatacagcagacctaaagtgg
acagttcctgagaaagatggagggtcccctatcaccaactacattgtggaaaagagagat
gttaggcgaaaaggctggcaaacagtggacacaactgtcaaggacaccaagtgcacagta
actccactgacagagggctctttatacgtgttccgagttgctgcagaaaatgccatcgga
caaagtgactactgtgaaattgaggactctgtcctggccaaagacaccttcaccacccct
ggtccaccctacgctctggcagtggttgatgtaaccaagagacatgttgacctgaagtgg
gaaccacctaaaaatgatggtggaagaccaatacagagatatatcattgagaagaaagag
aagttaggtacccgttgggtgaaagctggaaagactgcaggccctgactgtaacttcaga
gtaactgatgtcattgaaggaacagaggtccaatttcaggttcgggcagaaaatgaagct
ggagttggtcacccaagtgaacccacagaactcctgtcaattgaagatccaaaaggtcct
ccttcacctcctcttgacttgcatgtgactgacgctgggagaaagcacattgccattgcc
tggaagcctccagagaaaaatggtggaagtcctattataggataccatgttgaaatgtgt
ccagtaggcactgagaaatggatgcgagttaattctcgcccgataaaagacttgaaattc
aaagttgaagaaggcgttgttcctgacaaggagtacgtcctgagagtaagagctgtcaat
gctgtgggtgtcagtgagccatctgaaatctccgaaaatgtggttgccaaagacccagac
tgccagccaacaattgatatggagactcatgacattgttgttatcgaaggtgaaaagtta
agcattcctgtccccttccgagctgtcccagttccaactgttagttggcataaagatggc
aaagaagtcaaagcaagtgatagattaacaatgaaaaatgatcacatctctgcacacctt
gaagttcccaagagtgtccatgcagatgctggaatttataccattacgctggagaataag
ctcggctcagcaactggctcaattaatgtcaaagtcataggcctacctggaccatgcaaa
gatattaaagcaagtgatgtgaccaagagttcttgtaaattaacctgggaacctccagaa
tatgatggtggaagcccaatccttcattatgtcctggaacgcagagaggctgggaggagg
acatatataccagtcatgtctggtgaaaacaaactgtcttggactgtaaaagatctcata
ccaaatggtgaatacttcttccgtgttaaagctgtcaacaagattggtggaggcgaatat
attgaactgaaaaatccagtcattgctcaagatccaaagcagccccctgatccacctgta
gatgttgaggttcataatcctacagctaacgcaatgactattacatggaagccacctttg
tacgatggaggaagcaaaataatgggttacatcatagaaaagattgctaagggtgaagac
aaatggaagaggtgtaatgaacacctagtaccagtcctgacctacacagccaaaggactt
gaagagggaaaggaataccaattccgagtgcgagcagaaaatgctgccggcattagtgaa
ccttctcgggccactcctccaaccaaagctgtagatcctattgatgccccgaaggtcatt
atgagaacaagcctcgaagtgaaacgtggtgatgaaatagcacttgatgcaaccatctct
gggtcaccttacccgactattacatggctaaaggatgaaaaagtcattataccagaagaa
attaagaagcgagtagcacccacagttaggaggaagaggggtgaagttcaagaagaagaa
ccatttgtcctgcctctgacagaacgtttgagtattgacaacagtaaaaaaggagagtct
cagctacgtgtccgagattcaatccgacctgaccatggcctgtttatgatcaaagctgaa
aatgaccatggtattgctaaagctccctgtactgtcagtgtgctagatacaccaggacca
ccaatcaactttgtatttgaagatattagaaagaactccgtcctctgtaaatgggaacca
cccctcgatgatggtggcagtgaaattataaactatactttggaaaagaaagacaagaca
aaacctgactcagagtggattatcatcactgcaacacttagacactgcaaatattcagtg
acaaaactaattgaaggaaaagagtacctctttcgagtaagagctgaaaataggtttggg
cctggaccaccgtgtgtttcaaagccacttatagctaaagatccatttgaaccacctgat
gcacctgataagcccattgtggaagatgttaccagcaacagtatgctagtgaaatggaat
gaaccaaaagataatggaagtcccatcttgggttactggcttgaaaaacgggaggttaat
agcacacattggtctcgtgtcaacagaagccttctgaattctttgaagaccaatgtagaa
ggcctattagaaggactcacctatgtcttcagagtatgtgccgaaaatgcagctggacct
ggaaagttcagtcctccttcagatcccaaaacagcacgtgatccaatctctccacctggg
ccacctgtcccaagagtcactgacacaagctctacaactattgatctagaatgggaaccc
ccagctttcaatggtggtggggaaattgttggctactatgttgataagcagctggttggc
acaaatgaatggtcacgctgcacggagaagatgatcaaggtccgtcagtacactgtcaaa
gaaatccgagagggtgccgattataaactccgagtgagtgctgtcaatgctgcaggtgaa
ggaccaccaggggagacaggacctgtgactgtggctgaaccacaagagcctccaactgtg
gaactggatgtttctgtcaaggctggaatacaaataatggctggaaagactcttagaatt
ccagctgtggtaactggtcgcccagtgcctaccaaagtatggaccatagaagaaggggag
ctggataaagaccgtgttgtaatagagaatgttggaacaaaatctgagctcattatcaag
aatgccttgagaaaagatcatggaagatacgtgattacagctaccaacagctgtgggtcc
aaatttgcagcagccagagtagaagtctttgatgttcctggaccagttcttgacttaaaa
cctgttgtaacaaataggaagatgtgtttgcttaactggtctgatccagcagatgatgga
ggaagtgaaatcacaggattcattattgaaagaaaagatgcgaagatgcatacctggaga
caaccaatagagaccgagcgatctaaatgtgatatcacaggtctccttgagggacaagag
tatatgttccgggtgattgccaagaacaagtttggctgtggccctcctgttgaaatagga
ccaattcttgcagttgatccactaggtcctcccacgtctcctgagaggctcacatacaca
gagaggacgaagtccactattacccttgactggaaagagccccgcagtaacggtggcagc
cccatccaaggctatatcattgaaaaacggcgtcacgacaaacctgactttgaaagagtt
aacaaacgactctgcccaaccacatcttttctggttgaagatcttgatgagcaccaaatg
tatgaattccgtgtcaaagctgtcaacgaaattggcgaaagtgaaccatccctgcctctg
aatgtggtcatacaagatgatgaagtgcctccaactattaagttgcgcctgtctgttcga
ggagacactatcaaagttaaggcgggagagcccgttaacatccctgcagatgtgacaggc
cttccaatgcctaagattgagtggtccaagaatgaaactgtgatcgaaaagcccaccgat
gcacttaagataactaaggaagaagtatcccggagtgaggcaaagacggagcttatcatt
cccaaagcagtgcgggaagacaaaggcacttacacggttactgcttccaatcgcctgggc
tcagtgttccgaaacgttcatgtggaagtatatgatcgtccatcaccaccaagaaatctt
gctgttactgacattaaagctgaatcctgctacttgacatgggatgcccctctagacaac
ggtggcagtgaaatcacccattatatcattgacaaacgtgatgcaagcaggaagaaaagt
gaatgggaggaagtcaccaacactgctgtagagaagagatatggggtctggaaacttatc
cccaatggtcagtacgagttccgagttagggcagtgaataaatatggaatcagtgatgag
tgcaaatcagataaagtggtcattcaagatcccttccgccctcctggacctccaggaaaa
ccaaaagttctggagcgcacaaaagggtcgatgctagtgagctggactcctcctctggac
aacggcggttctccaattactggctactggctggagaagagagaagagggaggtgcctac
tggtcacgtgttagccgagcaccgataaccaaagtgggattgaaaggcgtggaatttaac
gttccccgcttgactgaaggtgttaaataccagttcagagcaatggcaataaatgccgca
ggagttggccctcccagtgaaccatcagatccagctgttgcaggagatcctatctatcca
cctgggccaccctcttgcccagaggtcaaagataaaacaaagtccagcatctcactggca
tggaaacctccagccaaagatggtggcagtccaatcaaaggatacattgtagaaatgcaa
gaagaaggtagtactgactggaaaaaagtaaatgagcccgacaaactactgactacctgt
gaatgtgtggtgccaaacctgaaagaactcaggaagtacagattcagagtgaaagctgtc
aatgaagctggtgaatctgaaccaagtgatacaactggagagattcttgccactgatatt
caagagccaccagaagtttttattgacattggagcacaagactctctggtttgtcaagct
ggctcccaaattaggattcctgctgtcatcaagggacgcccaacaccaaaatcatcttgg
gaatttgatggaaaggcaaagaaggcagtgaaggatggagttcatgatgtacctgaggat
gcacaggtggagactgctgaaaactcatcggtcattattattccggaatgcaaacgatct
cattcaggcaaatacagcatcacagccaagaataaagcaggacagaagacagcgaattgt
agagttaaagtcatggatgtaccagggccgcccaaagatctgaaagtcagtgacatcaca
aggggtagttgcagactcacatggaagatgccagatgatgatggaggagacaggatcaag
ggctatgttatagagaaaaagactattgatggaaaagcctggactaaagtcaatccaaac
tgtggaagcacctcatttgtggttcctgatctcatctctgaacagcaatatttcttccgg
gtgcgtgcagaaaaccgttttggtattggtccacccgtagaaaccattcagaggaccacg
gccagagatccaatatatcctcctgacccccctattaaactcaagatcggtctcataaca
aagaacacagtacacctatcatggaaacccccaaagaatgatgggggctcccctgtcacc
cactatattgttgagtgccttgcatgggacccgactgggacaaagaaagaagcgtggaaa
cagtgcaacaagcgtgacgtagaagaactggaatttactgttgaagacctcatagagggt
ggggaatacgaattcagggtcaaggctgtcaatgctgcaggagtcagcaaaccttcagcc
actgttggccccgtgactgtcaaagaccagacgtgcccaccttcaattgagctaaaagaa
ttcatggaggttgaagaaggaacagatgttaacattgtggccaaaattaagggtatgcca
ttcccgacactcacctggtttaaagcgcctccaaggaagcctgataagaaagaacctgtt
gtctatgacacccacgtcaacaaactggtagtggatgatacctgcacgttagttattcca
cagtctcgcaggagtgacactggcttatataccatcacagctgtgaataatctgggaacg
gcatcgaaggagatgagactgaatgtcctcggtcgtcctggccctccagtgggaccaata
aagtttgaaaatatttcagcagatcaaatgacattatcttggcttccacctctagatgat
ggtgggtctaagattacaaactatgtaattgagaagagagaagctaacaggaagacatgg
gtgcatgtctccagtgaacctaaagagtgcacgtacacaattcccaaattgctagaaggc
catgaatatgtattccgaatcatggcccagaataaatttggtgttggggagcctcttgac
agtgaacctgaaacagcaagaaacctattctctgtccctggaccaccagataaacccaca
gttagcagtgtgactcgcaactccatgactgtcaactgggaagagccagaatatgatgga
ggctctcctgtaacaggatactggctagaaatgaaagacaccacttcaaagagatggaag
agagttaaccgagatcctatcaaagccatgactttgggtgtttcttataaggtgacgggt
cttattgaaggctctgattatcaattccgtgtgtatgcaatcaacgctgctggtgtgggt
ccagcaagtctgccatcagacccagtgactgctagggatccaattgcccctcctggtcct
ccaattcccaaagtcacggactggactaaatcatctgtggatttagagtggtctccgcca
ctgaaagatggtggatccaaagtaactggatacattgttgaatataaagaagaaggaaaa
gaagaatgggaacagggtaaagataaagaagtgagaggaacaaagcttgttgtgacaggg
ttaaaagaaggagctttctacaaattcagagttagagcagtcaacattgctggcattgga
gaacctggagaagtgacagatgtcattgaaatgaaggacagaattgtgtcacctgacctt
cagctagatgccagtgtcagagacagaattgtggtccatgctggaggggtgatccggatc
atcgcctatgtgtccggaaaacctcctccaactgtcacctggaacatgaatgagagagct
ttacctcaggaagctaccattgagaccacagccattagctcctccatggtcatcaagaat
tgccagaggagccaccaaggggtctattctcttctcgccaagaatgcaggaggagaaaga
aagaagacaattatcgttgatgtattagatgtgccaggtcctgttggaataccattccag
gctcacaacctaaccaatgactcctgcaaactgacatggttttctccagaagatgatgga
ggctctccaatcaccaattatgtcattgaaaagcgcgaatctgaccgcagagcatggacc
cctgtgacatatacagttacccgacaaaatgctactgtccagggtctcattcaagggaaa
gcctactttttccgaattgcagcagaaaatagtgttggcataggcccatttactgagaca
ccaactgcactcgtaatcagagatccaataactgtaccagagcgtcctgaagacctggaa
gtcaaagaagttactaaagattccgttactttgacttggaaccctcctaaatatgatggt
ggatcagaaattattaactatgtcctagaaagccgtctcattggaactgagaagttccac
aaagttacaaaggacaacttgcttagcaggaaatacactgttaaaggcttgaaagaaggt
gatacctatgagtaccgtgtcagcgccgtgaatattgttggacaaggcaaaccatcgttt
tgtaccaagccaatcacttgcaaggatgacctggctcctccaacgcttgacctcgacttc
agagacaagatcacgattcgggttggtgaagcttttgccctcactggccgttactcaggc
aaaccaaaaccaaaagtttcttggttcaaagatgaagctgacgtgctagaagatgatcgc
actcacataaagaccactccaacgacacttgccctggagaagatcaaggccaaacgttca
gattctggcaaatactgtgtggttgtggagaacactacaggctctaggaaaggtttctgt
caagtcaatgttgttgaccgtcctggaccaccagtaggaccggttatttttgatgaagtg
accaaagattacatggttatctcttggaagccacctttagatgatggaggcagtgaaatt
accaattacattattgagaagaaggaggtgggcaaagacatttggatgcctgtgacatct
gcaagtgctaaaacaacatgcaaagtttctaaacttcttgaaggaaaggattatattttc
cggatccatgctgaaaatctgtatggaataagtgatcctctggtgtctgattcaatgaaa
gcgagagatcgtttcagggttcctgatgcacctgaccagccaattgttaccgaagttacc
aaagactctgcattagtaacctggaacaaaccaaatgatggaggaaagcccatcacaaac
tacatcctggaaaagagggaaactatgtctaaacgatgggctagagttaccagagagccc
atccatccatacactaagttcagggttcctgatcttctagaagggtgtcaatatgaattc
cgggtttctgcagaaaatgaaatcggtattggagatcccagccctccatccaagccagtc
tttgctaaagatccaattgctaaaccaagtccacccgtcaatcctgaagcaattgataca
acatgtaattcagttgatctaacttggcagccaccacgtcatgatggtgggagcaagatt
ctgggttatattgttgagtaccagaaagttggagatgaagagtggaagagagccaatcac
actcccgagtcatgtcctgaaactaaatataaagtcactggccttcgggatggtcagacc
tataagttcagagtaatggcagtcaacgaagcgggtgaatcggatccagctcatgttccc
gagccagtgctcgtaaaagacagacttgaaccccctgagttgattcttgatgccaacatg
gcaagagaacaacacataagggttggtgacactctaagacttagtgccgtcatcaaaggc
gtgccattcccgaaagtaacttggaaaaaaggagacagagaggctccaactaaagcaaga
attgatgttactccggttggtagcaagcttgaaattcgtaatgctgcccatgaagatggt
ggaatttattctttaactgtggagaatccagctggctcgaaaactgtctcagtgaaagta
ctcgtgctagataagccggggccacctagagatctggaagtcagtgaaattaggaaagat
tcttgttaccttacttggaaggaaccactagatgatggtggttctgttattacaaattat
gtggttgagaggagagatgttgccagtgcccagtggtcacctctttcaactacttcgaag
aaaaagagtcacttagctaaacaccttaatgaaggcaatcaatatctcttccgagtagct
gccgaaaaccagtacggacgtggtccttttgttgaaacacccaaacccatcaaggctctg
gatcctctacatcccccagggccacccaaagacttacaccatgtagatgtcgacaagact
gaagtctcccttgtttggaataagcccgatcgtgatggtggctccccgatcactggctat
ttggtggaataccaagaagagggcaccgaagactggattaagttcaagactgtgacaaac
ttagagtgtgttgttactggactgcaacaaggaaagacctatagattccgtgtaaaagct
gaaaatattgtgggtcttggtctccctgacacaactatcccaatagaatgtcaagaaaag
ctagtgcctccgtctgtggagctggatgtgaaattgattgaaggcctcgtggtaaaagct
ggaaccactgtcaggttccctgccatcataagaggtgtacccgttcccactgcaaagtgg
acaactgatggcactgagattaaaacagatgaacactacacagttgaaacggacagcttc
tcatcagtgcttaccattaagaactgcttacggagagatactggggaatatcaaatcaca
gtttccaatgcagctggcagcaaaacagtagcggtacatcttactgttcttgatgttcct
ggtccaccaacaggccctattaatattctggatgttacccctgagtacatgactatctcg
tggcagccacctaaggatgacgggggaagccctgtgataaattatattgttgagaaacaa
gacacaaggaaagacacatggggtgttgtttcatcaggaagcagtaagacaaagctgaaa
attccacatctgcaaaaaggctgcgaatatattttccgagtcagagcagagaataagatg
ggtgttggtcctccccttgactccacgcctactgttgctaaacataagttcagtcctcca
tctcctcctgggaagccggtagttactgacattactgaaaacgctgcaacggtgtcttgg
actctgccaaagtctgatggtggcagtccaataactggttactatgtggagcgtcgagaa
ataactggcaaatgggtgagagtcaacaaaacacctattgctgacctgaagtttagagtg
actggactgtatgagggaaacacatatgaatttagggtttttgctgaaaatcttgcagga
ctaagcaatccatccccaagttctgacccaataaaagcttgccggcccatcaaaccaccc
ggaccacctattaatcctaaactgaaagacaagaccaaagaaacagctgacttggtgtgg
acaaagcctctcagtgatggtggcagccccattctaggctacgtagtggaatgtcagaag
cctggtaccacacagtggaataggattaataaagatgaactcattaggcagtgtgccttt
agggtacctggactaattgaaggaaatgagtacagattccgtataaaagcagctaatatt
gtgggggagggagagccaagagaactagcagaatctgtgattgcaaaagacatccttcat
cctccagaagtagaacttgatgttacttgtcgtgatgttattaccgttagggtgggccaa
actatccgcattcttgctcgagtcagaggcagacctgatccagacataacttggtccaag
gaaggcaaagtattggtccgagaaaagcgggttgacataattcaagacctacctcgtgtt
gagttacaaattaaagaagctgttagagctgatcatggcaaatatattatctcagctaag
aatagcagtgggcatgcccaaggtttcaccattgttaatgttcttgacagacctgggcct
tgccagaacttaagggttagcaatgttaccaaagagaactgcacaatttcttgggaaaac
ccactagataatggtggctcagaaataacaaatttcatagtggaatatcgcaaaccaaac
cagaaaggctggtcaattgttgcctcagatgccactaagcgattaattaaggccaacctc
ttagccaacaatgaatactatttccgagtttgtgcagagaataaagtaggtgttggacca
accattgaaacgaaaactccaatcctggccattaaccctattgataggccaggtgagcct
gaaaaccttcacatcgcggataaaggaaagacgtttgtctatctcaagtggcggcggccc
gattatgatggtggtagcccaaatctgtcctatcatgttgagaggaggctgaagggctct
gatgactgggaaagagtgcataaaggaagcattaaagaaacccattacatggttgacaaa
tgtgttgaaaaccagatttatgagttcagagtgcaaacaaagaatgaaggtggggaaagt
gactgggtgaagacagaggaagttgttgtgaaggaagacctacagaaaccagtacttgat
ctgaagttaagcggtgtgctaacagtcaaagcaggggacaccattagactggaggcaggt
gttagaggcaaaccattcccagaagttttatggaccaaagacaaagacgcgacagactta
acaagatcaccaagggtcaagattgataccagcgctgattcatccaaattctctcttact
aaagcaaagcgaagcgatggtggtaaatacgtgattacagcgactaacacggctggcagt
tttgtggcctatgccactgtcaatgttttagataagcctggtcctgtaagaaatctgaaa
attacagatgtgtccagtgatcggtgtactattcgctgggatccaccagaggatgatggt
ggctgtgaaatccaaaattatattctagagaaatgtgagagtaagagaatggtttggtcc
acctattctgctaatgtcttaactcctggtactacagtaacacgtctcatagaaggaaat
gaatatattttcagagtccgtgcagaaaataaaataggcacagggcctccaacagaaagt
aaaccggtcattgcaaaaaccaaatatgacagacctggtcgcccggatcccccagaagtc
accaaagtaagcaaagaagagatgactgtggtttggaatccacctgaatatgatggtgga
aaatccatcacaggatactttttggagaaaaaggaaaggcattcaacacgatgggtccct
gttaacaagagtgcgatccctgagagacgtctcaaagtacagaacctcctcccaggacat
gaatatcagttccgtgtcaaggcagaaaatgaaattggaatcggagaaccaagcttgccc
tcaaggccagtggtggcaaaagaccccatagaaccacctggtccaccaaccaatctcaaa
gtggttgacacaaccaaaagttccataactcttggatggggaaaaccagtgtatgatgga
ggtgcaccaataattggttatgttgtggaaatgagaccaaaacgagaagatacatcacct
gacgaaggctggaaaaggtgtaatgctgcagcacaacttgttcgcatggagttcactgtt
accagcttggatgaaaaccaggaatatgagttcagggtgtgtgcccaaaaccaagctggc
attgggcgccctgcagaactaaaggatgctattaaacctaaagaaatcctagaacctcct
gagattgatttggatgccagcatgaggaaactggtcacagtgagagcaggatgccctatt
cgactatttgccatagtgagaggacgaccagctcctaaagtcacatggcgaagagtgggt
attgacaacgtggtcagaaaaggacaagttgatctggttgacaccatggccttccttgtc
atccccaattctacccgtgatgactcaggaaaatattccttgacgcttgtgaacccagca
ggagaaaaggccgtgtttgtgaatgtcagagtattagatactcctggacctgtgactgat
ttaaaagtttcggatgtcacaaaaacctcatgccacatttcctgggcccctcctgagaat
gatggtgggagccaagtgacacattatatcgtggagaagcgtgaagcagagagaaagacg
tggtcgaccgttaacccagaagtcaagaaaacgagctgccaagtcaccaatctcgtccct
gggaacgagtactacttcagagtaactgctgtcaatgagtatggccctggtgtgccagca
gatgtccccaaaccagtgcttgcatcagatcctctgtgtgagccggatcctccaaggaaa
ctagaagttactgaaatgacaaagaacagtgctacgttagcctggttacctcccctgcgt
gatggaggtgctaaaatcgatggctacatcataagttacagagaagaggaacagcctgca
gatcgctggacagagtactcagtggtaaaagatctcagcctggtcgtcactggcctaaag
gaaggaaagaagtataaatttagagtagcggccagaaatgctgttggagtcagtttgcca
agagaagctgaaggagtatatgaggccaaagaacagctgttgcctccaaagatccttatg
ccagagcaaattactattaaggctgggaagaaactccgagttgaagcccacgtgtatgga
aagccccatccagtctgtaaatggaaaaaaggagaagatgacgtcgtcacttccagccac
ctggcagtgcacaaagcagacacttcttcaatcctgatcattaaagatgttactaggaaa
gatagtggttactacagcctcactgcagagaacagttccgggacagacactcaaaaaatc
aaaattatcgtcatggatgctcctgggccccctcagcctccatttgacatttctgacata
gatgctgatgcttgctccctgtcatggcacatccctctggaggatggaggcagtaacatc
accaattacatagtagagaaatgtgacgtgagccgaggtgattgggtgacagctctagct
tcggtgacaaaaacttcctgcaggattggaaaactgatcccaggccaggagtatatcttc
cgagtccgtgctgaaaatcgatttggcatttcagagcctctcacatctccaaagatgcta
gctaagttcccatttggtgttcctagtgaaccaaagaatgcacgagtcactaaagtcaac
aaagactgcatatttgtggcatgggacagaccagacagcgatggagggagtcccattacc
ggttatctgattgaacgcaaagaaagaaacagtttgctctgggtgaaagctaatgatact
cctgtccggtcactggaatatccttgtgccggccttgtagaaggtcttgagtattcattc
agaatctatgcactaaacaaagctggatccagcccacccagcaagccaacagaatacgta
accgcaagaatgccagttgatcctcctggaaagcctgaagttatcgatatttccaagaat
actgtgtccctcatctgggctcgtccaaaacacgatggaggcagcaaaattattggctat
tttgtagaagcttgcaaacttcctggtgataagtgggtacggtgcaacacctcacctcac
cagattccccaggaggagtacacagtcactggcttagaggaaaatgctcagtatcagttt
agagcaattgccaagaccgcagtaaacattagccagccctctgaaccttctgatccagtg
accatccaggcagaaaatgttcctcccaggatagacctgagtgtggctatgaaatctttg
cttaccgtgaaagctgggactaatgtttgcctggatgctactgtttttggtaaaccaatg
ccaacagtctcttggaagaaggagggcacactcctgaaaccatcagaaggcataaagatg
gccatgcagcggaacctgtgcaccctggagctgttcagcgtgaacagaaaggactcaggc
gactataccattactgccgaaaattcaagcggctccaaatcagccacaattaagcttaaa
gtgttagataaaccaggtcctccagcatctgttaaaatcaacaaaatgtatgcagatcgt
gcaatgctttcttgggaacctcctcttgaagacggaggctcagaaatcaccaactatatt
attgacaaacgtgaaacaagcagacccaactgggcacaggtctcggcgactgtgcccatt
accagctgcagcgtggagaaacttatagagggccatgagtatcagttccgaatttgtgct
gagaataaatatggagtgggggatccaatcttcacagaaccagcagttgctaagaaccca
tatgacccacccgggcgctgcgatcctcctgttattagcaacataaccaaagatcacatg
acagtcagctggaaaccaccagcagatgatggcggctcacctatcactggctacttggta
gaaaagagagaaacccatgcagttaactggactaaagtcaacaggaaacctgttatagaa
agaacaataaaagcaacaggtctccaagaaggcaccgaatacgagttccgagttacagct
ataaataaggctggaccagggaaacccagtgatgcatccaaagctgcttatgcccaggac
cctctgtatcctcctggcccaccagcttttcccaaagtatacgataccacccgcagctcc
gtgagtctatcgtggggcaagccagcctatgacggtggtagccctatcattggttacctt
gtcgaagtaaaacgagctgactctgataactgggtgaggtgcaatttaccacagaagcta
cagaaaacccgcttcgaggttactggcctaatggaaaacacagaatatcagttccgtgtg
tatgctgttaataagattggatacagcgaccccagtgatgtgccagacaaacactgtccc
aaggacatcttaattccacctgagggagaactcgatgctgatttgaggaaaacactcata
ctacgtgccggagttacaatgagactgtatgtaccagtaaaaggacgtccacctccaaag
ataacttggtctaagccaaatgtcaatctaagagaaaggattggacttgacataaaatca
acagactttgacactttcttgcgctgtgaaaatgtgaacaaatatgatgcaggaaaatat
atcttgactctggagaacagctgtggtaaaaaggaatacaccatcgtagtgaaagtgctt
gatactcctgggccacctgtcaatgtcactgttaaggaaatatccaaagactctgcttat
gttacctgggatcctcccattattgatggcggaagtcccatcataaactatgtggtagaa
aaacgtgatgcagagaggaagtcctggtctacggtgacaactgagtgctcaaaaacaagc
ttcagagtgtccaacttggaggagggaaaatcctacttcttcagggtgtttgctgaaaat
gagtatggcattggtgatcctggtgaaacacgtgatgccgtcaaagcttccgaaactcct
ggaccagttgtggacctgaaagtgatatccgtaactaagtcgtcctgtaacattggctgg
aaaaagcctcgcagtgatggtggaagtcgaattattggatatgtagtggatttcctgact
gaggataataagtggcaacgtgttatgaaatcattaagcttacagtactccgcaaaagat
ttgactgaaggcaaggaatataccttcagagtgagtgctgagaatgaaaatggagaagga
accccaagtgaaatcactgctgtggcaaaggatgatattgtggctcctgaccttgactta
aaggacatacctgatttgtgctacttggctaaagaaaacagcaacttccgtcttaagatc
cccataaagggcaagccagctccatcagtatcctggaagaaaggggaagatcctctagca
actgacacaagagtcagtgtcgagtccactgccgttaacacaactcttgtggtacacgac
tgccaaaaatctgatgctgggaaatacacaatcacgctgaagaatgttgccggcaccaag
gaaggaactctctctataaaagttgttggcaagcctggcatccccacaggaccgatcaaa
tttgaagaagtcacagcagaagccataaccttaaagtggggtcctccaaaggatgatgga
ggttctgagatcaccaactatatcctagagaagagagattctgtaaacaacaagtgggtg
acgtgtgcctcagctgtccagaaaaccaccttcagagtaaccagacttcacgagggcatg
gaatataccttcagggtcagtgccgaaaataaatatggtgtaggagaaggcctgaaatca
gacccagttgttgctaaacatccatttgatgtgcctgatgctcccccacctcctaatatc
gtggaagtcagacatgattcggtatctctaacttggactgaccccaggaaaaccggtggc
tccccaattacagggtatcatattgaattcaaggaaagaaacagcctaatgtggaagaga
gctaacaagactcctatcaggatgaaagacttcaaagtgacaggattaactgaaggtctt
gaatacgaattccgagttatggcaatcaatttagcaggagtaggcaagccaagcctgccg
tcagagccagttgtggcacttgatccgattgatcctcctggcaaacctgaggttattaat
gtaacaaggaattcagtgaccctcatttggactgaacccaaatatgacggtggtcataag
ctgactggatatatagtggagaagcgggatctaccctctaaatcttggacgaaagccaac
catgttaatgtcccagattgtgcctttaccgtcactgaccttgttgaaggtggaaaatat
gaattcagaattagagcaaagaatacagcaggtgctatcagtgctccctcagaaagtaca
ggaaccgttatttgcaaggatgaatacgaggcaccgaccattgtccttgatcccacaata
aaagatgggctgacaattaaagcaggagataccattgttttgagtgccattagcattcat
ggcaagccccttccaaagtcgagttggtctagggcaggaaaagacattagaccatcagat
atcgttcagatatcttcgaccccaacatcttccatgcttactgtcaagtatgccactaga
aaagatgcaggtgaatataccattactgctaccaatccttttggcacaaaggaggaacac
gtgaaggtaacagtcctcgatgtacctggtccccccggtcccattgaaatcagtaacgtt
tctgctgaaaaagcaacgcttacgtggacaccgccattggaggatggcggctcaccaatt
aagtcctatgtccttgaaaagagagaaaccagtcgacttttgtggacagtggttgctgaa
gacattcagtcttgcaggcatgtggcaaccaaacttatccaagggaatgagtacgtcttc
cgggtctcagctgtcaaccagtatgggaaaggagaacctgtacagtcggaacctgtcaaa
atggtggacagattcggtccccctggccctcctggaaaaccagaggtatcaaatgtcact
aaaaacactgccactgtcagttggaaaagaccagtggatgacggtggtagtgaaatcaca
ggatatcacatcgaaaggagagaaaagaaaagcttacggtgggtgagagcaacaaagatg
ccagtttcggatctcagatgcaaagtaacaggactgcaagaaggaaacacctacgaattc
cgggtcagcgcggaaaacaaagccggaattggtccacctagcgaagcctcaaatcctgtc
ctgatgaaagacgtagcatatcccccaggcccaccttcaaatgcacgtgtcaccgacact
accaaaaaatctgcttctttagcatggggcaagcctcattatgacggaggacttgaaatc
actggctatattgtagagcatcaaaaagtaggagatgaggcctggataaaagatacaaca
ggaactgctctccgaatcactcaatttgttgtccctgatctgcagaccaaagaaaaatat
aattttagaatcagagccatcaatgatgcaggtatcggggagccagcagtgattccagac
gttgaaattgtggaacgggaaatggctcctgattttgaactagatgctgagcttcgaaga
acactggttgttagagcaggactcagtattagaatattcgtgccaattaaaggtcgtcct
gctcctgaagtgacgtggaccaaagacgacatcaacctgaaaaaccgagctaacattgag
aatacggaatcatttactcttctcattataccagaatgtaacagatatgacactggtaaa
tttgtcatgaccatcgaaaacgctgctgggaagaaaagtggctttgttaatgtcagagtc
ttggataccccaggacctgtccttaacctgaggcctactgacatcacaaaggacagtgtc
accctgcactgggaccttcctctgatagatgggggctcacgtataacaaactacatcgtg
gagaaacgagaagcaacacggaaatcttactccacagtcagcacgaagtgccacaaatgc
acatataaagttactggcttgtcggaaggttgtgaatacttcttcagagtgatggcagaa
aacgaatatggaattggtgagccagcagaaacaacagaacccgtgaaagcctctgaggca
ccatcaccaccagatagtctgaacattatggacataactaagagcacagtcagcctggcg
tggcctaaaccaaagcacgatggtggcagtaagatcactggctatgtaattgaagcccag
agaaagggctctgaccagtggactcacatcacaaccgtgaaagggctagaatgtgtggtg
aagaatctaacagaaggagaggaatataccttccaagtgatggctgtgaacagtgcagga
agaagtgcccctagagaaagcagacctgtcattgtcaaggagcagacaatgcttccagaa
ttggatctgcgtggcatttatcagaaattggtcattgccaaagctggtgacaacatcaaa
gttgaaattccagtgcttggtcggccaaagcccacagtcacgtggaaaaaaggagaccag
attcttaaacagacacagagagttaattttgaaaatacagcaacttcaaccatcttaaat
atcaacgagtgtgtaagaagtgatagcgggccctatccattgacagcaaggaacattgta
ggagaggttggtgatgtcatcaccattcaagtccacgatatcccagggccacccactgga
ccaatccgatttgatgaagtctcatctgattttgtaaccttctcttgggacccgcccgag
aacgacggaggtgtaccaataagcaactacatagtagaaatgcggcagaccgacagcact
acatgggttgaactagcaaccaccgtcatacgcactacctataaagccactcgcctcact
actggagtggagtatcaattccgggtaaaagcacaaaatagatatggagttggaccaggc
atcacatcaacacctatagttgccaactatccatttaaggttcctgggcctcctggaacc
cctcaggtgactgcagttaccaaagattctatgacaattagctggcatgagcctctttct
gatggtggaagccccattttaggatatcacattgaaagaaaagaacgaaatggtattctc
tggcagaccgtgagcaaagcattggtgccaggcaacattttcaaatctagtggacttaca
gatggtattgcttatgaattccgagtgattgcagaaaacttggcaggcaaaagcaagcca
agcaagccatctgaacctatgcttgctttagatcccattgacccacctgggaaaccggtt
cctctgaatattactagacacacagtgacacttaaatgggctaagcctgaatacactgga
ggctttaaaattaccagttatatagttgaaaagagagaccttcccaatggacggtggcta
aaggccaacttcagcaatattctggagaatgaatttacagtcagcggcctaacagaagat
gctgcctacgaattccgagtgattgccaaaaacgccgctggtgctgttagtccaccgtct
gagccatcagatgctatcacgtgcagggatgacattgaagcaccaaagataatggtggac
gttaagtttaaagacacaataatattaaaagcaggagaagcattcaagctagaagctgac
gtttcaggtcgcccacttccaacgatggaatggaccaaagatggaaaggagcttgaaggc
acagcaaagctagaaataagaattgcagatttctctacttatctgataaacaaagattca
acaagaagggacagcggtgcgtatatcctcacagcaactaatcctggtgggtttgctaaa
cacattttcaacgtcagagtcctcgatagaccaggcccacctgaaggacctttagctgta
tctgaagtgacagcagaaaaatgtgtactgtcgtggttgcctccactggacgacggaggt
gccaagattgaacattacatagttcagaaacgtgagaccagcagattggcgtggacaaat
gtcgcctcagaagtccaagtgacaaagctgaaggtcactaagcttttgaaaggcaatgaa
tacatattccgtgtcatggctgtaaataaatacggagttggagagccactggaatcagag
cctgtgcttgccgtaaatccgttcagaccccctgatccacccaaaaaccccgaagttaca
gccatcactaaagactcgatggttgtctgctggggacatcctgactccgacggtggaagt
gaaatcatcaattatatcgtagaacggcgtgataaagctgggcaacgctgggtgaaatgc
aacaaaaagactcttactgatttgagatacaaggtgtctggactaacagaagggcatgag
tatgagttcaggatcatggctgaaaacgccgctggaattagcgcaccgagttccacgagt
ccgttttataaagcttgtgacgctgtgtttaaacccggcccaccagggaacccacgcgtt
ctagatacaagcagatcatccatttcaattgcttggaataaaccgatctacgatggtggc
tcagaaatcactgggtacattgtcgagattgcccggcccgaggaagatgagtggcagatt
gtcactccaccagctgggctcaaggcaacttcttacaccatcaccaacctcgtagagaat
caggaatataaaatccgcatctatgccatgaactccgaagggatgggagagcctgcgctg
gttcctgggaccccgaaggctgaagagaggatgctgcctccagagattgagctggacgct
gacctgcgcaaagttgtcaccataagagcttgttgcaccctgagactgtttgtccccatc
aaaggcaggccagcccctgaggtgaagtggacccgggaacacggagagtccttagataaa
gccagcatcgaatccacgagctcttacaccctgctcatcgtcggaaacgtaaacagattc
gacagcggcaaatacatactcacggtagaaaacagctcgggcagcaagtctgcgtttgtc
aatgttagagtcctagacaccccaggccccccgcaggacctcaaggtgaaggaggtcact
aagacatctgtcacgttgacgtgggagcctcctctccttgatggcggttcgaaaataaag
aactatattgttgaaaagagggaatcaaccagaaaagcatattcaactgttgcaacaaat
tgccacaagacgtcctggaaggtagaccagcttcaggaagggtgtagttactatttcagg
gttcttgctgagaacgaatatggcatcgggctgcctgccgaaactgcggaatctgtgaaa
gcctcagaacgaccccttccaccaggaaaaataactttggtggatgtcaccagaaacagc
gtgtcactctcttgggaaaaaccagagcacgacggaggcagtcgaattctaggctacatt
gtggagatgcagagcaaaggtagcgacaagtgggccacatgtgccacagtcaaagtcacc
gaagccaccataaccggattaattcagggtgaagaatactctttccgtgtgtccgctcag
aacgaaaagggcatcagcgatcccaggcaactgagcgtgccagtaattgccaaagacctt
gtcatcccaccagccttcaaactcctgttcaccactttcactgtactggccggtgaagac
ctaaaagttgacgttccattcattggacgccctacgcctgctgtaacctggcataaagac
gacgtgccactgaagcagaccactagagtaaatgcggagagcacagaaaataattcacta
ctgacaataaaggaagcctgccgagaagatgttggacattacacagttaaactgactaac
tcggctggcgaagctaccgaaacccttaatgttattgttcttgacaaaccagggcctcca
accggacccgttaaaatggatgaagtgacagctgacagtattactctttcctggggcccc
cctaagtacgacggtgggagttctatcaataattacatcgtagaaaaacgggacacttcc
acaaccacctggcaaattgtatcagctactgttgcaaggacaacaatcaaggcctgtaga
ttaaagaccggatgtgaataccagtttaggatcgcagctgaaaacagatacggcaagagc
acatacctgaattcagagcctgtcatagcccagtatccattcaaagtccccggccctcct
ggcacgccatttgtaacgctcttctccaaggacagcatggaagtacagtggaatgagcca
gtgagtgacggaggtagcagagtcatcggctatcatctagagcgcaaggaaagaaatagt
atcctctgggtgaagttgaataaaacgcccattcctcaaaccaagtttaagaccactggc
ctcgatgaaggcattgaatatgaatttagagtctctgcagagaacatcgtgggcatcggc
aagccaagtaaggtgtcagaatgctacatggcgcgtgacccgtgcgatccgcctggacgg
ccagaggcaattattgtcacacgaaactctgtgacgctccagtggaagaaacccacttat
gatggtggaagcaagatcaccggctacattgtagagaagaaagaattgcctgatggccgc
tggatgaaagccagttttacgaatgtcattgacactcagtttgaagtaactggcctagtt
gaagatcagaggtatgagttccgggtgatagctcgaaatgctgcaggagtgtttagtgag
ccttcagaaagcacgggagcaataacagcaagagacgaggtagatccaccacgaataagt
atggatccaaaatacaaagacacaattgtgcttcacgctggtgagtcattcaagattgac
gcagatattcacggcaaaccaataccaaccattcagtgggtaaaaggtgatcaggagctt
tcaaatacagctcgattagaaataaagagcacggactttgccaccagtctcagcgtaaag
gatgcagtacgcattgacagtggcaattacatactgaaggccaaaaatgtcgcaggggag
agatcagttactgtaaatgtcaaggtcctcgatagaccagggccccctgaaggacctgtt
gtggtatcaggagtgacagcggaaaaatgcacactagcttggaaacccccactacaggat
ggtgggagtgatatcataaattatattgtggaaaggagagaaaccagccgcttagtttgg
actctggttgatgccaatgtgcagactctcagctacaaggttactaagcttctcgaaggc
aatgaatatatcttccgtataatggctgtaaacaaatatggtgttggtgaaccgcttgaa
tctgagccagtaattgccaagaatccgtttgtagtgccagatgcaccaaaggctccagaa
atcaccacagtgaccaaggactcaatggttgttgtatgggaaagaccggcatctgatggt
ggcagtgaaattcttggatatgttcttgaaaaacgggataaggaaggcattcgatggaca
agatgccacaaacgcctgattggggaattgcgcttgagagtaactggactcctagaaaat
cacaattatgagttcagagtctcagccgagaatgctgctggactcagtgaaccaagccta
ccttctgcttaccaaaaggcttgtgatcctatttataaaccaggacctccaaacaatccc
aaagtcatagatattaccagatcttctgtcttcctttcttggagcaaaccaatatatgac
ggtggctgtgaaatccaaggctacattgtcgaaaaatgtgatgtgagtgttggcgaatgg
accatgtgcactccaccaactggaatcaataaaacaaatatagaagtagaaaagctattg
gagaagcatgagtacaatttccgtatctgtgctgtcaataaagctggagttggagaacat
gcggatgtcccaggacctgttatagttgaagaaaaattagaagcaccagacattgaactt
gacctagaactaaggaaaattattaacataagggcaggtggctccttaaggctatttgtt
cccatcaaaggtcgtcctacaccagaagttaaatgggggaagatggatggtgaaatccga
gatgcagctataattgatgtcactagcagtttcacctctctcgttcttgacaatgtcaac
cgatacgatagtggaaaatacactctcacattagaaaacagcagtggaacaaagtctgcc
tttgttactgtgagagtcctggacacaccaagtccacctgttaacctgaaagtcacagaa
atcactaaagactcagtatcaattacatgggaaccgcctctgctggatgggggatccaag
attaaaaattacattgttgagaaacgtgaggccacaagaaaatcatatgctgcagttgta
acaaactgccataagaattcttggaagattgaacaactccaggaaggctgcagttattac
ttcagagtcacagctgagaacgagtacggtattggccttcctgcccacactgctgatcct
attaaggttgcagaagtcccacaacctccaggaaagataactgtggatgatgtcaccaga
aacagtgtttccttgagttggacaaagcccgaacatgatggtggcagtaaaatcattcag
tatattgtggaaatgcaagctaagcacagcgagaaatggtcagagtgtgctcgagtcaag
tccctcgaagcggtaattactaacctgactcagggagaagaatacctctttagagttgtg
gccgtaaatgaaaagggaagaagtgatcccaggtcccttgctgttccagtagttgcgaaa
gatctggtcatcgagccagatgtgagacctgcattcagcaactacagtgtacaggttggc
caagatttgaaaatagaagtgccaatttctggacgtcctaagccaaccattacctggact
aaagatggtcttccactgaagcagaccacaagagtcaacgttactgattcccctgacctc
accgtactcagcattaaagaaacgcataaggatgacggtggacactatggaatcacagtt
gctaatgttgtgggtcagaaaacagcatccattgaagttataactctagataaacctgat
cctccaaaaggacctgttaaatttgatgaagtcagtgctgaaagtattacactatcttgg
aaccccccaacatacacagggggctgccaaatcaccaactacattgttcagaaaagagac
acaaccaccacggtatgggacacggtttctgctactgttgccagaaccacactcaaagtg
accaaactgaaaactggtacagaataccaattcagaatatttgctgaaaacaggtacgga
caaagctttgccctggagtcggagccaattgtagctcaatatccctacaaagaaccaggc
cctccaggcacaccatttgtcacagccatttccaaagacgccatggtcgttcagtggcat
gaaccaatcaataacggcggaagccccgtcataggttaccaccttgagaggaaggaaaga
aatagcattttgtggacaaaagtcaacaaaactattattcatgacactcagtttaaagca
ctcaatcttgaagagggcattgaatatgagttcagagtttatgctgaaaatattgttggt
gtaggtaaagcaagcaagaattccgaatgctacgtagccagagatccctgtgacccgcca
ggaaccccagaagcaataatggttaaaagaaatgaaatcactttacagtggaccaaacct
gaatatgatggcggaagtatgattacaggttacatcatagagaaacgtgatttgcctgag
ggtcgctggatgaaagccagcttcacaaatgtcatcgagactcaatttaccgtgtcaggc
cttactgaagatcaaagatatgagtttagagtcattgcgaagaatgcagctggtgtaata
agtaaaccctctgacagtactggaccaataactgccagggatgaggttgaacttccaaga
atttcaatggatccaaaattcagagacacaattgtggtgaatgctggtgaaacattcagg
cttgaggctgatgtccacggaaagccccttcctaccattgagtggttacgaggagataag
gaaattgaagaatctgccagatgtgagataaagaacacagattttaaggctttacttatt
gtgaaggatgccattagaattgatggtggacagtatattttaagagcttccaatgttgca
ggttctaagtctttcccagtaaatgtaaaagtattggacaggccaggacctccagaaggg
ccagtccaggttactggagtcacttctgaaaaatgctctttgacatggtctccaccactt
caagatggtggcagtgacatttctcactatgtcgttgaaaagagagaaacaagtcgactt
gcctggactgtggttgcttcagaagttgtgaccaattctctgaaaattaccaaactctta
gaagggaatgaatatattttccgcataatggctgtcaacaaatacggtgttggggagcct
ttggaatctgcaccagtactgatgaaaaatccatttgtgcctcccggaccaccaaaaagc
ttggaagtcaccaacattgccaaggactccatgaccgtctgttggaaccgtccagatagt
gacggtggaagtgagattatcggctacattgtagagaagagagacagaagtggcatcagg
tggataaaatgtagtaaacgccgcattacagatttgcgtctgagggtaacaggattaaca
gaagatcatgaatacgaattcagagtctctgcagaaaatgctgctggagtgggagaacca
agtccagctacggtttattataaggcttgtgatcctatattcaaacctggtccacccacc
aacgcacacattgtggacaccactaaaaattcaattacactcgcttggggtaagcccatc
tatgatggtggcagtgagatcataggctacgtagtagaactctgtaaagcagacgaagaa
gaatggcaaatagttactccacagactggcctgagagccactcgatttgaaatttcaaaa
ctcattgagcaccaagaatataaaatacgagtctctgccctcaataaagttggcttaggt
gaggctacgtcggttcctggtactgtgaaaccagaagataaacttgaagcacctgaactt
gaccttgactctgaattaaggaaaggaatagttgtcagagctggtgggtcggccagaatt
cacattccattcaagggtcgcccaacaccagagatcacttggtctcgagaggaaggtgaa
ttcacagataaggtccaaattgaaaagggggtaaactatacccaactatcaatagacaac
tgtgatagaaatgatgccggaaaatacattctcaagctggaaaacagcagtggatctaaa
tccgcttttgtgactgtgaaagttttggacaccccaggacctccacagaatttgacagtc
aaagaggttaaaaaggattctgtccttctggtatgggaaccacccatcattgatgggggt
gcaaaggtgaagaactatgttattgacaaacgtgagtcaaccagaaaagcatacgctaat
gtgagtagtaaatgcggtaaaacaagctttaaagttgagaatcttacagagggagccatt
tattactttagagtcatggctgaaaatgaatttggagttggtgttccagtggaaactgtt
gatgctgtgaaagctgctgaacctccttccccgccaggaaaagtgacactcacggatgtg
tcccagaccagtgcatcactgatgtgggagaaacctgaacatgatggtggtagcagagtc
ttgggttatgttgttgaaatgcagcccaaaggaaccgaaaaatggagtactgttgccgaa
tccaaagtctgtagtgcagtcattactggtttgagttctggacaagaatatcagttccgg
gtcaaggcttataacgagaaagggaaaagcgatccaagagtgctcggtgttcctgtcata
gccaaggacttgaccatacagcctagttttaagttgccatttaacacatataccgtccag
gctggagaggatcttaaaatcgaaatcccagttatcggccgaccaagacctgaaatttca
tgggtcaaagatggtgagccttttaaacaaacaacaagagtaaatgttgaggaaacagct
acttcaactattttgcacattaaagaaagtaacaaagatgactttggaaaatacactata
acagcaacaaatagtgcaggtaccgccacagaaaatctcagcattattgttttggaaaag
cccggacctccaactggaccagttcggttcgatgaagttagcgcagactttgtggtcata
tcttgggaacctccagcctatactggtggctgccaaataagcaactacattgtagagaag
cgagatacaactaccaccacttggcagatggtatcagcaacagttgcgagaacaacgatt
aaagtaaccaaactgaaaacaggcacagagtaccagtttagaatttttgcagaaaacagg
tatggaaagagtgcccctctcgattctaaaccagttgttgtacaatatccatttaaagaa
cctggaccgcctggaactccttttgtgacatcaatttcaaaagatcaaatgattgtgcag
tggcatgagccagttaacgatggtgggagcaaagttatcggctaccatcttgaacagaaa
gaaaagaacagcattttatgggtcaaattaaataagattcccattcaagacaccaaattc
aaaacaaccggacttgatgaaggacttgagtatgagttcaaagtttctgctgaaaatatc
gttggcatcggcaagcctagcaaagtgtcagaatgctttgtcgctcgtgatccatgtgac
ccacctggccgccctgaagccattgttatcacaaggaacaatgtcacactgaaatggaag
aaacctgcttatgatggtggtagcaaaataacaggttatatcgtagaaaagaaggatcta
cccgatggccgctggatgaaagccagcttcaccaacgtgttagagactgaatttacagtg
agtggacttgtagaagaccagcgatatgaatttagagtaattgcaagaaatgcagctggc
aactttagtgaaccgtctgaaagcactggtgccattactgcacgagatgaaattgatgca
ccgaacgcctcactggatcccaaatataaagacgtaatcgttgttcacgcaggagagact
tttgtccttgaagctgacatccgcggcaagcccatacccgatatcgtttggtcaaaagat
ggaaaagagcttgaagaaacagctgcgaggatggaaattaaatctactattcagaaaacc
actcttgttgtcaaagactgtatacgtactgatggaggacagtatattctgaaactcagc
aacgttggtggtacaaagtccataccaatcactgtaaaggtacttgacaggccagggccc
ccagaaggacctctgaaagtttctggagttactgctgagaaatgttacctggcgtggaac
ccgcctttacaggacggtggtgctaatatctcacattacatcattgaaaagagagaaaca
agcagactctcctggacccaggtttccactgaggtccaggccctcaactacaaagtcact
aaactgcttcctggtaatgagtacattttccgtgtcatggctgtcaataaatacggaatt
ggagagcccttggaatccgagcctgtgatagcccgtaatccttataaaccaccaggtccc
ccttcaccacccgaagcctcagcaatcaccaaagattctatggtggtaacatgggcacgc
ccagtggatgacggaggtgccgaaattgagggctacattcttgaaaaacgagataaggaa
ggcattagatggaccaagtgcaacaagaaaactctaacagatctccggttcagggtaact
ggccttaccgaaggtcattcctacgagttcagagttgctgccgaaaacgcagctggcgtg
ggtgaaccaagcgagccatctgttttctaccgtgcctgtgatgctctgtatccaccaggt
ccaccaagtaatccaaaagtgacggatacttccagatcttctgtctccctggcgtggagt
aagcctatttatgatggcggtgcacccgttaagggctatgtcgttgaggtcaaagaagct
tctgcggatgaatggacaacttgcactccaccaacaggattacaaggaaagcaattcaca
gtgaccaagcttaaagagaacactgagtataacttccgtatctgtgccatcaattctgaa
ggtgtgggtgaacctgcaactatacctggctcagttgtggcgaaagagaggctggagcca
ccagaaatagaactcgatgctgacctgagaaaggtagtcgttctgcgggcaagtgctact
ttacgcttatttgtcaccatcaaaggtcgaccggaacctgaggttaaatgggagaaggcc
gaaggcattctcactgagagggcccagatcgaggtgaccagctcatacacaatgttagtc
attgataacgtcaccagatttgatagcggtcggtataacctgacgctagaaaataacagc
ggttctaagacagcttttgttaacgtcagagttcttgactcgccaagcgcccctgtgaat
ttgaatgtaagagaagtaaagaaagactcggtgatcttgtcttgggagccaccacttatc
gatggtggagcgaagattacaaactacattgtcgaaaaacgagaaactacaagaaaagca
tatgctacggttacaaacaactgcaccaagaatacatttaaaattgaaaatctacaagaa
ggatgttcttactacttccgagtcttggcttccaatgaatacgggatcggtttgccagct
gaaacaactgaacccgttaaagtttctgaaccacccctcccacccggaagagtgaccctt
gtcgacgtgacccgcaatacagctacaattaagtgggagaaaccagaaagtgacggtggc
agcaaaattactggttatgtagttgaaatgcagactaaagggagtgaaaaatggagcact
tgcacacaagttaagactctggaggcgactatatctggcctaactgcaggagaagagtac
accttcagggtagctgcagtgaatgaaaaaggaagaggtgacccgagacaacttggagtg
ccggtaattgcacgggacattgaaataaagccctcagttgagcttcctttcaatactttc
aatgtaaaggctagagaccaactgaagattgatgttccatttaaaggaagacctcaagcg
accgtaagctggaaaaaggacggtcagattcttaaggaaacgacacgggtcaacgtctct
tcttcaaagaccgtaacatcactctccattaaggaagcttcaagggaagatgtcggaact
tatgaattgtgtgtttcaaacagtgccggggccataaccgttcctattactgtgatcgtc
cttgacaaaccagggcctccaggacctgttcacatcgatgaggtcagttgtgacaatgta
accatttcttggaatcctccagaatacgatggcggctgccaaatcagcaattacatcgtt
gaaaagagagaaaccacttctaccacatggcacgtggtttcacaagcagtggcaagaaca
tccattaaaatagttcgtctgaccacaggaagtgagtaccagttccgggtgtgtgcagaa
aaccgctttggcaggagctcctacagcgagtctgcacctgttgttgcagagtatccattc
agccccccgggccctcctggtactcctaaagtcgtgcatgccacaaaatcgaccatgatt
gtaagctggcaagtgccagttaatgatggaggaagtcaagtaattggctatcaccttgaa
tataaagagagaagcagcattctttggtccaaagcaaataaaatcctcatcgccgatacg
caaatgaaagtctccggcctcgacgaaggactgatgtatgagtatcgtgtgtacgctgag
aacatcgctggaatcggcaaatgcagtaaatcctgcgaaccggtccctgcaagggatcct
tgtgatcctcccggacaacctgaagtcacaaatatcacaagaaaatcagtgtcgcttaag
tggtccaaaccacattatgacggtggagctaagatcacaggctacattatcgaacgtaga
gagctaccagatggccggtggctgaagtgcaattttactaacgtacaagaaacatacttc
gaagtgaccgaacttactgaagaccagcgttatgaattccgtgtttttgcaaagaatgcg
gctgactccgttagcgagccatctgaatccacggggccgattacagtgaaagacgatgtc
gaggctccaagaatcatgatggatgtcaagttccgagacgttattgttgtcaaagctgga
gaggtcctgaagataaacgcggacattgcagggcgacctctgccggtaatttcctgggcc
aaggatggggtcgaaattgaagaaagagcaagaacagaaattgtctcaacagactataac
actgtgctaacggtgaaggactgtgtccgacgagacactgggcagtatatactaaccctg
aagaatgttgcaggaactcggtctatggcagttaattgcaaggtacttgataagcctggc
ccacctgcaggaccacttgaaataagtggcctcacggctgagaaatgctccctttcctgg
ggaccaccccaagaaaatggtggtgcagatatcgactattacatcgtagaaaaacgtgaa
acaagccgcctcgcgtggacgatatgtgaaggagagttaaggacaacatcctgtaaagta
accaagctactcaaaggcaatgaatacatctttagagtaacaggtgttaataaatatggt
gttggtgagtccctggagagcacggcagtaaaggcactaaatccatttacggttccaagt
ccacccacatctttggaaattacatctgtgaccaaagagttcatgaccctttgctggtcg
agacctgagagtgatggaggcagtgaaatctctggatatataattgagaggcgagagaaa
aacagcctacgatgggtgcgggtaaacaaaaaaccagtttatgacctgagagtgaaatca
accggacttcgggaaggatgtgaatatgagtaccgggtttatgcagaaaacgctgctggc
ctgagccttccaagtgaaacctctcccttgattcgggcagaagacccggtgttcttgcca
tctcctccatccaaacccaagattgtggactcgggcaagacaaatataactatcagctgg
gttaagcccttgtttgatggtggggccccagtaactggatacaccgtagaatacaaaaaa
tctgatgaaactgagtgggaaactgcaattcagaacttaagaggcacagaatatactata
ggtggactaactacaggagccgaatatgttttcagagtaagatctgtcaataagatcggt
gctagtgatcccagtgatagctcggatccccagatcgcaaaagaaagagaagaagaacct
gtatttgatcttgacagtgaaatgaagaagaccttgattgtcaaggccggttcctcattt
accatgaccgtacctttccggggaagaccagtgcctagtgtctcgtggagtaagccagac
actgacctccgcaccagagcttatattgattccacagactctcgtacgtcacttactatt
gaaaatgccaaccgaaatgattctggaaaatatacactaacaattcagaatattttgaat
gctgcttcactgaccttagttgtcaaagttttagattctcctggtcctccagccaatatt
accgtacatgatataaccaaagaatctgctgtgttatcctgggatgttcctgaaaacgac
ggtggagctccagtgaaaaattaccacatagaaaaacgtgaggccagtaagaaatcatgg
gtctctgtgaccaacaactgtaaccgcctctcctacaaagtcaccaacctacaagaaggg
gccatctactacttccgggtctctggagagaatgagtttggtgttggtgtgccagctgaa
acaaaggaaggagtaaaaataacagaaaagccaagcccacctgaaaaacttggagtaaca
ggtgtatccaaagacagtgtttccctgacctggctgaagccagaacacgatggtggaagc
agaattgtacactatatcgttgaagcagtagaaaagggacagaaaaactgggttagatgt
gcagtggtgaagtcaacccatcacattgtttctggtctgagggagaattctgaatacttt
ttccgggtgtttgctgaaaatcaagctggtctgagtgacccaagagagctcctgcttccc
gttcttattaaggaacaactagaaccacctgacattgatatgaagaacttcccaagtcat
actgtatatgttagagctggctcaaaccttaaagttgacattccaatttctggtaaaccg
ctgcccaaagtgaccttgtcaagagatggtgtgcccctgaaagcaaccatgagatttaat
actgaagttaccgctgagaacctgaccatcaatctcaaagaaagtgttaccactgatgct
ggaagatatgagatcactgctgccaactccagtgggacaaccaaagctttcattaacatc
attgtactggacaggcctggtcccccaactggccctgttgttatcagtgacataacagaa
gaaagcgtgactctcaaatgggagccacctaagtatgatggtggaagtcaagttactaat
tacatcgtactcaagagagagacaagtactacagtatggactgaggtgtctacaacagtt
gcaagaaccacgattaaagtcatgaaactgaccacaggagaagaataccagttccgcatc
aaggcagaaaaccgctttggcatcagtgatcacatagattcagcgtgtgtgactgtcaaa
cttccatacacaacacctggaccaccatctacaccatgggtcactaatgttactcgagaa
agcatcaccgtggcctggcatgaaccagtgtccaatggaggcagcgcagttataggctat
cacctggaaatgaaagacagaaacagtattttatggcaaaaagccaacaaattggttatc
cgcacaactcacttcaaagtcacaacaatcagtgctggacttatttatgaattcagggta
tatgcagaaaatgctgctggtattggaaaacccagccatccttccgaaccagttctagcc
attgacgcctgtgaacctccaagaaatgtccgtatcactgatatttcaaagaactctgtc
agcctttcatggctacagccagctttcgatggaggaagcaagattacaggctatattgtt
gagaggcgagatcttccagatggcagatggaccaaggccagcttcaccaatgttatcgag
actcaattcattgtctctggcttgactcagaattcccagtatgaattccgggtctttgct
agaaatgccgttggttcggtcagcaatccatccgaggttgtaggccccattacatgcatt
gattcttatggtggacccgtaattgatttgcctctagaatacacagaagttgtcaaatac
agagccggtacatctgtgaagctcagagccggcatttccggcaaacctgagcctacaatt
gagtggtataaagatgataaagagttacaaaccaacgccctggtatgcattgaaaatacc
accgaccttgcatctgtactcatcaaagatgcaaatcgccttaatagtggaagctacgaa
ttaaaactgaggaacgccatgggctcggcctcagccaccatcagagtacagatccttgac
aaaccaggacctccgggtggtccaattgaatttaagacggtcactgctgaaaaaataact
cttctctggcgccctccagcggatgacggtggtgcaaaaatcactcactacattgtggaa
aaacgcgagacaagccgcgtagtgtggtctatggtgtctgaaaatttggaagagtgcatc
atcaaaaccaccaaaatcatcaaaggaaatgaatacgtcttccgagttcgagccgtgaac
aaatacggaattggtgatccactggaatccgagccagtggtggcaaagaatgcctttgtt
actcctgggcccccgggcataccagaggtgacaaagatcaccaagaattcaatgaccgtt
gtctggagcagaccagttgcggatggtggtagtgaagtaagcggctattaccttgagaaa
agagacaagaagagtctcggatggtttaaagtcttaaaggagactatccgtgacaccaga
gagaaagtgacaggactcacggaaaacagtgactaccaataccgagtttgtgctgtcaat
gctgctggtcagggtccattttctgaaccatctgacttctacaaagctgctgatcctatt
gaccctccaggcccaccagctaagataagagttgcagattcaaccaaatcatccatcact
cttggctggagtaaacccgtctatgatggaggcagtgctgttactggatatgttgtcgcg
atgagacaaggagaggaagaggaatggactgttgtctctaccaagggagaggtcagaact
acagaatatgtggtatctaatctgaaacctggagtcaactactacttccaggtatctgcc
ataaactgtgctggacaaggagaacctatagaaatgactgaacctgtacaagctaaagat
atacttgaggaaccagagatcgacctagatgtggctctcagaacctctgttatagctaaa
gctggtgaagatgtacaagtgttgattccctttaaaggcagacctccacctactgtcaca
tggagaaaagatgagaagaatcttggcagtgatgccagatacaacatccaaaacaccgat
tcttcttcgttactcattattcctcaagtcactcgcaatgatacaggaaaatacattctc
acaatagaaaatggcgttggtcaacccaagtcttcaaccgtgagcgttaaagtgcttgat
acaccagccgcctgccagaaactacaggttaaacatgtttctcgaggcacagtcactttg
ttctgggatcctcctctcattgatggaggatctcccataattaattatgtcattgaaaag
agagatgccaccaagagaacatggtcttcagtgtcacacaaatgtaccagtacatccttt
aagataacagatttgtcagagaaaacaccattcttcttcagagttcttgcagaaaatgaa
attggaattggggaaccttgtgaaactacagaaccagtgaaggctgctgaagtcccagct
cctatacgtgatctctcaatgaaagactcaacaaagacatctgttaccctaagttggacc
aagcctgactttgatggtggtagcgtcatcacagaatatgttgtggaaaggaaaggtaaa
ggtgaacaaatgtggtcacatgctggcataagtaagacctgtgaaattgaagttggccaa
cttaaggaacagtcactcctggaattcagagtgtttgccaaaaacgataaaggactgagt
gatcctgtcactattgggccaattacagtgaaagaacttgtgattacacctgacgttgac
ctgtcagatatccctggggcacaagtcgctgtgagaattgggcataatgtgcacctcgaa
ttaccttataaaggaaaacccaaaccatctatcagttggctgaaagatggtttgccattg
aaagaaagcgagtatgttcgtttcagtaaaactgaaaacaagattactttgagtattaag
aatgtcaagaaggagaatggagggaaatacaccgttattcttgataatgcagtttgtaga
acctcaattcccattacaatcatcacacttggcccgccatcaaagcccaaagggcctatt
cgatttgatgaaatcaaggctgacagtgtcatcatgtcatgggacgtgcctgaagatgac
ggaggaggagaaattacttgttacagcattgagaagagggaagcttcacaaactaattgg
aagatggtgtgttcaagtgttgccaggacaaccttcaaagttcctaatctagtcaaagat
gctgaatatcagtttagggttagggcggaaaatagatatggagtcagccagcccctcgtc
tcgaacaccattgtggcaaaacaccagttcaggattcctggccccccaggaaagcccgtt
gtatacaatgtgacttctgatggcatgtcactaacttgggatgctccagtttatgatggt
ggttcagaagttactggattccatgttgaaaagaaagaaagaaacagcatcctctggcaa
agagttaacacatcgccaatatctggaagagaatatagagccaccggcctaatggaaggc
ctagattaccagttccgtgtatatgctgaaaattctgctggcctaagctcacccagtgac
ccaagcaaatttactttagctgtttctccagtagacccgcctggcactcctgactacatc
gatgtcacccgggaaaccatcacacttaaatggaaccctccattgcgagatggaggcagt
aagattgtggcctacagcattgagaaacggcaagggagcgatcgttgggtcagatgcaac
tttactgatgtcagcgaatgtcagtacacagtcacaggacttagtcctggggatcgatat
gagttcagaataattgcaagaaatgccgttggtactataagtcctccctcacagtcttct
ggcatcatcatgacaagagatgaaaatgttccaccaacggtagagtttggcccagagtat
tttgacggtatcattattaagtctggagagagcctcagaattaaagctttggtgcaggga
cggccagtacctcgcgtaacttggttcagagatggagtagaaattgaaaagaagatgaac
atggaaataactgatgttctaggatccaccagccttttcgtgagagatgctacccgggaa
caccgtggtgtataccgcgtggaagccaaaaatgcatctggctcctcaaaagcagaaatt
accgtgaaagtacaagatacaccaggaaaagtagttgggccaataagattcaccaatatt
actggcgagaagatgaccctgtggtgggacgctccactcaatgatggctgtgctcccatc
actcactacatcattgaaaaacgggaaaccagcagacttgcttgggcactaattgaggac
aattgtcaagcccacagctatactgccactaaactaataaccggcaatgaataccagttc
cgtgtttctgcggttaacaagtttggtgttgggcggccacttgattctgacccagtggtt
gcacaaatacaatacactattcccgatgcccctggcactccagaacctagtaatgtaaca
ggcaatagcattaccctgacatgggcaaggccagaatcagacggtggcaatgaaattcaa
cagtatatcctggaaaggagagaaaagaagagcacacgatgggtaaaagtgatcagcaaa
cgaccaatctccgagacgagattcaaagtcactggtctgatagagggtaatgagtatgaa
ttccatgtcatggctgaaaatgctgcaggaatagggcctccaagtggtatctcaagacta
atcaaatgtagagagccagtcagcccaccaagtgctcccactgtggtcaaagtgacagac
acatccaagacaactgtgagcctagaatggtctaagccagtgtttgatggcggcatggaa
ataattggatatattattgaaatgtgcaaagctgacttaggagactggcacaaggtgaac
gcagaggcatgtgtgaaaacaaggtatacagtcactgatctacaagcgggcgaagaatac
aaattccgggttagtgctatcaatggtgctggaaaaggagagagcagtgaagcgaccggc
gcaattaaagcagttgaccgattagcagctcctgagttagatatcgatgcaaacttcaag
cagactcatgttgtcagagctggagccagtattcgcctcttcatcgcctaccagggtaga
cctactcctacggctgtgtggaccaaacctgactccaaccttagcattcgggctgatatc
catacaacagactccttcagcaccctcactgtggaaaactgcaacagaaatgatgcaggg
aaatacacctttaccgtagaaaacaacagcggtagtaaatcaatcactttcactgtaaag
gtgctagatactccaggcccacctggcccaatcactttcaaggatgtgacccgtggatct
gttacgctcatgtgggatgctcctatccttgatggtggtgcccgaatccatcactatgtg
gtagaaaaacgagaagcgagtcgtcgtagctggcaggtgatcagtgaaaaatgcactcgt
cagatccttaaggtcagcgacctagcagaaggtgttccatactatttccgtgtttctgca
gaaaatgagtatggtgttggtgaaccctatgaaatgccagaaccaattgtagccacagaa
cagcctgctccacctaagagacttgatgtcattgacacaagcaaatcctctgcagtctta
gcttggcttaaacctgaccacgatggaggcagccggatcactggctaccttcttgaaatg
agacaaaagggatctgacttctgggtcgaggctggtcacacgaaacagctgactttcaca
gtggagcgcctggttgagaacactgaatatgaattccgagtgaaggccaagaatgatgct
ggctacagtgaacccagggaagccttctcttccgtcatcatcaaggagcctcaaatcgag
cccactgctgacctcactggaattactaatcagctcataacttgcaaagcgggaagcaca
tttaccattgatgtcccgatcactggtcgtcctgctcccaaagtaacatggaagcttgaa
gaaatgagacttaaggagacagatcgagtgagtatcacaacaacaaaagacagaaccacc
ctgtctgtgaaggatagcatgagaggtgactctggaagatacttcttgaccctggaaaat
acagctggtgttaaaacatttaccatcacggttgtggtcatcggaaggccaggtccagta
actggccccattgaggtctcatctatctcagctgaatcatgtgtcctgtcctgggctgaa
cctaaagatgatggaggcactgacattactaattacatagttgaaaagcgtgaatcgggt
acaacagcttggcagcttatcaactccagtgtcaagcgcactcagattaaagtcactcat
ctcacaaaatacatggaatattctttccgagtcagttcagagaacagatttggtgtcagc
aagcctctagaatcagcaccaatcattgctgagcatccattcgtcccaccaagtgctcct
accagacctgaagtctactacgtgtctgccaatgccatgtctattcgttgggaagaaccc
taccacgatggtggcagtaaagtcattggctactgggttgagaagaaagaacgtaacacc
attctttgggtgaaagaaaacaaagtgccatgcttagagtgcaactacaaagtgactggt
ttggtggaaggactagagtatcagttcagaacatacgcgctcaacgccgcaggtgttagc
aaagccagtgaggcttcaagacctatgatggctcaaaacccagtcgatgcaccaggaaga
ccggaggtgacagatgtcacaagatcaacagtgtccctgatttggtctgccccagtatat
gatggtggcagcaaggttgtgggctacatcatagagcgtaagccagtcagtgaagttgga
gatggtcgctggctaaagtgcaattataccattgtatccgacaatttcttcactgtgact
gcgctcagtgaaggagacacttacgaattccgtgtgttggctaagaatgcagcaggagta
attagcaaaggatcagaatctacaggccctgtcacttgcagagatgaatacgctccgccc
aaagctgaactggatgccagactgcagggtgacctggttaccatcagagcaggctcggat
ctggtccttgatgctgcagttggtggcaaacctgaacccaaaatcatctggaccaaaggg
gacaaggaactagatctctgtgaaaaagtctccttgcagtatacaggcaaacgagcaacc
gctgtgatcaagttctgtgacagaagtgacagtggaaaatacaccttaacagtgaagaat
gccagtgggaccaagtctgtgtctgtcttggtcaaagttcttgattcccccggcccatgt
ggaaagctcactgtcagcagaataacggaggagaagtgcactttggcctggagccttcct
caggaagatggaggagcagaaataactcactatatcgtggaaagacgggagacaagcagg
ctcaactgggtgattgttgaagccgaatgcccgaccctatcctatgtagtaaccagactc
atcaagaacaacgaatacatattccgagtacgggcagtaaacaagtatggccctggtgtg
cctgtcgaatcagaaccaattgtagccagaaactcattcactatcccatcacaacctggc
atacccgaagaagttggggctggcaaagagcatatcatcattcagtggacgaaacctgaa
tctgatggtggcaatgagatcaagaactacctagtagacaaacgtgagaaaaagagcttg
cgctggacacgtgtcaacaaagactatgtgatatatgacaccaggctgaaggtgactggc
ctcatggaaggttgtgattaccagttccgggtcactgcggtgaacgctgctggtaacagc
gaacccagcgaagcttccaactttatcgcatgcagagaaccatcatatacccctggacca
ccttctgctccaagagttgtggataccaccaagtacagcattagtttggcatggaccaag
cccttgtatgatggtggcactgacatcacgggatatgttcttgaaatgcgagagaaggat
acggatcagtggtaccgagtgcataccaaggccacaataagaaataatgaattcaccgtg
ccagacctcaaaatgggccagaaatactccttcagggttgctgctgtgaatgtgaagggt
atgagtgaatacagcgagtcaactgctgaaattgagcccgtggaaagactagaaatacca
gacctagagcttgcagatgacttgaagaagactgtgaccatcagagccggggcctcattg
cgcctgatggtgtctgtatctggaagaccacctcccgtcatcacatggactaagaagggc
attgaccttgcaaaccgggcaattattgacaccactgacagctactctttacttatagtg
gacaaagttaaccggtacgatgctggaaaatacactattgaagccgaaaatcaatctggc
aagaaatcagcaacagtccttgttaaagtatatgatactcctggtccctgtccttcggtg
aaagtcaaagaagtatcaagagattctgtgaccattacctgggaaattcccacaattgat
ggtggcgctcctgtcaacaattacattattgagaagcgtgaagctgccatgagagcattc
aaaacagtaactaccaaatgcagcaagacactctaccgaatttctggactcgtagaagga
accatgtactatttcagagtgttgccagaaaacatttatggcattggggaaccctgtgaa
acatctgatgcggttctggtctcagaagtacctctggtgcctacaaagctagaagtggtc
gatgttaccaaatcaactgtcactctcgcttgggaaaaaccactctatgatggtggtagc
cgactcactggatacgttcttgaggcctgcagagctggcaccgagagatggatgaaggtt
gtcaccttaaaacccacggtcctagagcacactgttatttccctaaacgaaggcgaacag
tacctatttagagtacgggcacaaaatgagaaaggtgtgtcggaaccaagagagatcgtc
acagctgtgactgtacgagacctcagagtgttgccaacaatcgatctttctacaatgcct
cagaagaccatccatgtcccagctggcagaccagtagagcttgtgataccgatcgctggt
cgcccacctcctgctgcttcctggttctttgccggttctaaactaagagaatcagagcgc
gtcacagttgagactcatactaaagtagctaagctaaccatccgtgaaaccactatcaga
gatactggagaatacaccctcgaattgaagaacgtaactggaactacttcagagaccatt
aaagttatcattctcgataagcctggtcctccgactgggcctatcaagattgatgaaatt
gatgctacttcgattaccatttcctgggaaccacctgaattggatggtggcgcgccgctg
agcggctatgtagtagaacagcgtgatgcccaccgtccagggtggctgcctgtgtccgaa
tcagtgaccagacagacatttaagtttaccagactcactgaaggaaacgagtacgtgttc
cgtgtggctgcaaccaaccgctttgggatcggctcttacctgcagtcggaggtcatagaa
tgtcgcagcagcatcagtatccctgggcctccagaaacattacagatatttgatgtctcc
cgtgatggcatgacactgacgtggtatccaccagaaaacgacggcggctcccaagtgact
ggatatattatagagcgcaaagaagtgagagcagatcgatgggtccgtgtaaataaagta
ccagtgacgatgacgcggtaccgttccactggccttattgaaggcttagaatatgaacac
cgtgtcacagccattaacgtgagagggacgggaaaaccaagtcgtccttccaaacccatc
gttgccatggatccaattgctcctccaggaaagccgcaaaacccaagagttactgatacg
acaaggacatcagtctccctggcctggagtgttccagaagatgaaggaggatctaaagtc
acaggctacctgattgaaatgcaaaaagtagatcaacatgaatggaccaaatgtaacacc
actccaaccaagattcgggagtataccctaacacatctacctcagggcgctgaatacaga
ttccgtgtcctagcttgtaacgctggtggacctggggagcccgctgaggtaccaggaaca
gtcaaagtcactgaaatgcttgaatatcctgattatgaacttgatgaaagataccaagaa
ggtatctttgtaagacaaggtggagtcatcagacttaccataccaatcaaaggaaaacca
ttcccaatatgtaaatggaccaaggaaggccaagatgtcagtaagcgtgccatgattgca
acctctgaaacacacactgagcttgtcatcaaagaagcagacagggatgattctggcact
tatgacctggttctggaaaacaagtgtggcaagaagactgtctacatcaaagtcagggtg
ataggaaatcccaaccctcctgaagggccacttgaatatgatgacatacaagctcgctcc
gtaagggtcagttggagaccccccgccgatgacggtggcgctgacatcttaggctatatt
ctcgagaggcgggaagtgtctaaagccgcctggtatacaattgattccagagtccgaggt
acatccctggtggtaaagggcctcaaagagaacgtggaataccatttccgtgtttcagct
gaaaaccagtttggcataagcaaatccctgaaatctgaagaaccagtcataccaaaaaca
ccgctgaatcctccagagcctccaagcaatcctccagaggtactcgatgtgaccaagagt
tctgtcagcctgtcttggtcccggcccaaagacgatggtggttctcgggtcacaggctac
tacattgaacgcaaggagacatcaactgacaagtgggtcagacacaacaagactcagata
acgaccacaatgtacactgtcacggggcttgttcctgatgctgagtatcagttccgcatc
atcgcacagaatgatgttgggctaagtgagaccagcccggcttctgaaccggttgtttgc
aaagatccatttgataagccaagccaacctggggaacttgagattctttcaatatccaaa
gacagtgtcactctacaatgggagaaacctgaatgtgatggtggcaaagaaatccttgga
tactgggttgaatacaggcagtctggagacagcgcctggaagaagagcaataaggaccgc
atcaaggacaggcaattcacaatagggggtttgctggaatccactgaatatgaattcagg
gtttttgctgagaatgagactgggcttagcagacctcgaagaactgctatgtctataagg
actaaactaacatctggagaggcgccaggagtgcgcaaagaaatgaaggatgtgaccacc
aagttgggcgaagctgctcagttgtcatgccagattgttggaaggcccctgcctgacatt
aaatggtaccgatttggcaaggagctggtacaaagccggaagtataaaatgtcttcagac
ggacgcacacatacgctaacagtaatgacagaggaacaagaagatgaaggtgtttatacc
tgcatagctactaatgaggttggagaagtagaaactagtagtaagcttctcctgcaagca
acaccacaattccaccctggttacccactgaaagaaaaatattatggtgccgtgggttcg
acacttcgacttcacgttatgtacattggtcgtccagtaccttctatcacttggttctat
ggccagaaacttttgcaaaactcagaaaacattactattgaaaacactgagcactatact
catcttgtcatgaagaatgtccaacgtaagactcatgctggaaaatacaaagttcagctc
agcaatatttttggaacagttgattccatccttgatgtggaaatacaagataaaccagac
aaacctactgggccacttgtgatagaagctctattgaagaactctgtggtgatcagctgg
aaaccgcctgcagacgatggaggctcctggatcaccaactatgtggtggagaaatgtgag
gccaaggaaggggctgaatggcaattggtgtcttcagccatctcagtgacaacctgcaga
attgtaaacctcacagaaaatgctggctattacttccgggtttcagctcagaacactttt
ggcatcagtgaacctctagaggttgcctcagttgtgatcattaaaagcccatttgaaaag
ccaggtgctcctggcaaaccaactatcactgcactcacaaaagattcctgtgtcgtggct
tggaagccacctgccagtgatggaggtgcaaagattagaaattactaccttgagaaacgt
gagaagaagcagaataaatggattgctgtgacaacagaagaaattcgagaaactgtcttt
tcagtgcaaaaccttattgaaggtctcgaatatgagttccgtgtgaaatgtgaaaatctg
ggtggggaaagtgaatggagtgaaatatcagaacctgccactcccaaatctgatgtccca
attcaggcaccacactttaaagaggaactgagaaatctaaatgtcagatatcagagcaat
gctactttggtctgcaaagtgactggtcatccgaaacccattgtgaaatggtacagacaa
ggcaaagaaatcattgcagatggcttaaagtaccggattcaagagtttaagggtggctac
caccagctcatcattgcaagtgtcacagatgatgatgccacagtttaccaagtcagagct
accaaccaagggggatctgtgtccggcactgcttccctggaagtagaagttccggctaag
atacacttgcctaaaactctcgaaggcatgggagcagttcatgctctccgaggtgaggtg
gtcagcatcaagatccctttcagtggcaaaccagatcctgtgatcacctggcagaaagga
caagatcttatcgacaataatggccactaccaagttattgtcacaagatccttcacatca
cttgttttccccaatggagtagagagaaaagatgctggtttctatgtggtctgtgctaag
aacagatttggaattgatcagaagaccgtcgaactggatgtggcggatgttcctgaccca
cccagaggagtcaaagttagcgacgtctcacgagattctgtcaacttgacatggacggag
ccagcttctgatggtggcagcaaaatcaccaactacatcattgaaaaatgtgcaactact
gcagagagatggcttcgtgtaggacaggcccgagaaacacgttacactgtgatcaactta
tttggaaaaacaagctaccagttccgtgtaatagccgaaaataaatttggcctgagcaag
ccttcggagccttcagaaccaaccataaccaaagaagacaagaccagagccatgaactac
gatgaagaggtagatgaaaccagggaagtttccatgactaaagcctctcactcctcgact
aaggaactctacgagaaatatatgattgctgaggatcttgggcgcggtcagtttggaatt
gtccaccgctgcgttgaaacatcctcaaagaagacttacatggccaaatttgttaaagtc
aaggggactgatcaggttttggtaaagaaagaaatctccattctaaacattgctaggcac
agaaacatcttatacctccatgaatcatttgagagcatggaagagttagtcatgatcttt
gagttcatatcaggactcgacatatttgagcgcattaacacaagtgcttttgaacttaac
gaaagagaaatcgtcagttacgttcgccaggtctgcgaagcacttgagttcttacatagt
cataatattggacattttgacattagaccggaaaatatcatttaccaaacaagaaggagc
tccatcattaaaatcatagaatttggtcaagctcgtcagctgaagccaggggacaacttt
aggcttctgttcactgcccctgagtactatgcacctgaggtccaccagcatgacgttgtc
agcaccgccacagacatgtggtcccttggaacactagtgtacgtgctgttaagcggtatc
aatccattcctggctgaaactaaccagcagatgattgagaacatcatgaacgccgaatat
actttcgatgaagaagcattcaaagagattagcctcgaagccatggattttgttgaccgg
ctgttagtgaaagagagaaaatctcgcatgacagcatctgaggcactccagcatccatgg
ctgaagcagaagatagaaagagtcagcactaaagttatcagaacattaaaacaccggcgt
tactaccacaccctgatcaagaaagacctcaatatggttgtgtcagcggcccgaatctct
tgtggtggtgcaattcgatctcagaagggtgtcagtgttgctaaagttaaggtagcatcc
attgaaattggcccagtttctgggcagataatgcacgcggttggcgaagaaggaggatat
gccaaatatgtatgcaaaattgaaaattatgatcagtctacccaagtgacctggtacttt
ggagtcagacagctggagaacagtgagaaatatgaaatcacctatcaagatggagtagcc
accatgtatgtcaaagacattaccagattcgatgatggcacctacagatgcaaagtggtc
aatgactacggtgaagatagttcttacgcagagctatttgttaagggcgtgagagaaact
tatgactattactgccggagaaccatgaagaaaatcaagcgcagaactgatacgatgaga
ctcctggaaaggccaccagaatttaccttgcctctctataacaagacggcttacgtgggt
gaaaatgtccggtttggagtaactataactgtccacccagagcctcgtgtaacatggtac
aaatcaggtcagaaaatcaaaccaggcgacgacgacgggaagtacacattcgagtctgac
aagggtctttaccagttaacaatcagcaacgtaactatagatgatgacgccgagtacacc
gtcgtggccaggaacaagtacggcgaggacagctgtaaagcgaaactgaccgtaacccca
cacccaccgccaacagacacgaccctaagacccatgttcaaacggctgctggcgaacgca
gaatgccaggaaggccaaagcgtctgctttgagatcagagtgtctggcatccccccacca
acattaaaatgggagaaagacggccagccactgtccctcgggccgaacatcgaaattatc
cacgagggcctggattattacgccctgcacatcagggacactctgcctgaagacacaggc
tactacagggtcacagccacgaacacagctggatccaccagctgccaggctcacctccag
gtggaacgcctgcggtacgtcaaacaggaattcaagagtcaggaggagcgagagcgccac
gtgcagaggcaaattgacaagacgctgagaatggccgaaatcctgtctggcaccgagacg
gtgtccctgacccaggtggcccaagaggccctgagggaagccgccgtcctctacaagccg
gctgtgagcaccaagaccgtgaagggggagttccgcctggagaccgaagagaagaaggaa
gagaggagactccggatgccctacgaggtccccgagccgcgcaggtacaagcagagcagc
gtggaagaggaccagcgcatcaagcagttcgtgcctatgtccgacatgaaatggtacaaa
aagatacgcgaccaatttgaaatgcccgggaagatcgacaggatcgtccagaagaggccc
aagcgcatccgcctgtcgagatgggagcagttctacgtgatgccccttccccgcatcacg
gatcagtaccggccccgatggcgtctccccaagctgtcccaggacgacctggaaatggtg
aggccggcccgccgccgcaccccctcccccgactacgactacgactaccacttctattac
agacccaggagacgctctctcggcgacatgtcggatgaagaactgctcctccccattgac
gactacctggccatgaagaggacagaggaagagaggctgcggctggaagaggagctcgag
ctgggcttctccgcgtccccgccgagccggagccccccgcgcttcgagctctcgagtctg
cgagctcccgtcagcgtggaggagacgcggcgagacttcagctcctccacctaccacgtc
cccacccgggcggacacgagcacgagctacgcggccctgcgggagcgccacgcgcgggcc
tcgcacaggccgcccgggcagcggcagaggatgctggccgacagggaggacgaggagctg
ctgcgcccggtcgccaccagccagcggctctccgagtacaaaagccagctggaccacatg
tcaagggaggacaagtctagaaggaaatcgaggcgacagagagaggtgacagaaataacc
gaaatcgaggaagagtacgagatctccaagcacgctcagcgagaggcctccgtgcacgcc
cagagagcatccgagtccgagtcctcctccgtgtccaggctcctgaggcggcggcggtcc
ctgtcgcccacctacattgagctaatgaggccggtgtccgagctgatccggccccgtcgg
atccctccagaggacgaatacgaagaggacaccgaaaggaggtcccctactccagagaga
actcgcccacggtcccccagccccgtgtccagcgagaggtcactctccagatttgagagg
tctgcaagatttgatatcttttccaggtacgagtccatgaaagctgctctgaaaactcag
aagacgtcggaaaggatgtacgaagttttgagtcagcagccttttacgctggaccatgcc
ccccgggtcacgctgcgaatgcgctcccacagggtgcccgttggccaaaatacacatttt
atcttgaacgtccagtccaagccaactgccgaggtgaagtggtaccacaacggcgtcgaa
ctccaagaaagcagtaagattcgttacaccaacatgagcggggtgctgaccctcgagatt
ctggactgtcaggctgaggacagtggcacctaccgcgccgtgtgcaccaactacaaaggt
gaggcctcggactacgcgaccttggacgtaacgggcggggattacactacctacgcctcc
cggcgcagagacgagcaggtgcccccctcggtcttccccgagctgacgagaacagaggaa
tatgctgtttcgtcgtttaagagaacggctgagatggaagcttcttccgccgtcagggag
atgaagtcgcaggtgacggagacaagggaaagcatctcagcctacgagcaccacgcatct
gcagaaacgaggagcgctgccgtggaacagatggcgctggaggaaaagtccacacacagg
aagatcaagacgacgctggcagcaaggattctaacgaagccaaggtccataaccgtgtac
gaaggcgagtccgcaaggttctcttgcgacacggatggcgagccggtccccaccgtgacc
tggctgcgaggaggacaagtggtgagtacctccgcccgccaccaagtgaccacggccaag
tacaaatccacctttgagatctcttcagtccaggcctccgatgagggcaactacagcgtg
gtggtcgaaaacagcgaagggaggcaagaagcgcagttcactctgactattcaaaaggcc
agggtaaccgaaaaggccgtgacatcaccaccgagagtcaaatccccagagcctcgagtg
aaatctccagaagccgtgaagtctccaaaacgggtgaaatccccggaaccagccacttct
cacccaaaagccgtatccccccccgagacaaaacccacaccaacagagaaagttcagcag
ctaccagtctccgtcccacccaagataactcagtcgctgaaggcggaagcttccaaagac
gtggcaaagttgacctgtgcggtggagagtagcgtattatgcgcaaaggaggtcacctgg
tataaagatggcaagaaactgaaggaaaatgggcatttccagtttcattactcagcagat
ggtatctatgaactcaaaatccataacctcacggaatctgacagtggagaatacatttgt
gagatagcgagtgaaggtggcacttctaaaacgagcttccagtttatgggacaagccttt
aagagtgtccatgagcaggtgtcaaggatatccgaaactaagaaagcggctcagaagacc
gctgagtcaacagaaaccaagaaaatagaaccaaaagctcctgaaccagtttcctcaaaa
ccagtcattgtcactgggctgcaggatacaaccgcttcttcagacggtgtcgctaaattt
gcagttaaagctaccggagaaccccggccgactgtcacctggaccaaggatggaaaggct
gttacacaaggaagtaaatataaactctctgaagacaaaggagttttcctcttagaagtt
ctgaagactgatacttccgacagcgggctttatacatgcacagtgacaaattcagctgga
tctgtgtcctctagctgcaaattaactataaaagctgtaaaagacactgaggcacagaaa
atatctacacaaaagacctctgaaattgtgtcacaaaagaaggccactgtccaagaggaa
atttcccaaaaagccctaatttctgaagaaatgaaaatctcagaggtgaaatctcaagaa
aagttagccctcaaggaggaagcttcaaaggttcagatttctgaaaaagtcaagaaatca
gaagcaatctctctggaaaaatctatcgtccatgaggaaatcactaaaacatcacaggcg
tcggaagaaatacaaaggcatgccgagattaaagcatcttctactcagatgagcataacc
gatggtcagaaagtgaccttaaaagccaacattgctggtgccactgatgtgaaatgggtt
ctgaatggcgtggagctcactaactctgaggagtacagatacggtgtctcgggcagcgat
cagaccctaaccatcaagcaggcgggtcacaaagatgaagggatcctcacctgcataggc
aaaaccagccaagggatcatcaaatgtcagtacgatctgagcctgagcaaagaactctcc
aatgctccagccttcatctcacagcccagatctcaaaatattaacgaagggcaaaatgct
gtcttttcttgtgaaatcagtggtgagccatccccggaaatcgaatggtttaaaaacaac
ttgccgatttctgtttcttcaaatatcagtgtaagtcgctccagaaacgtctattctctc
gaaatccgaaatgcatcagtaagcgacagtgggaagtacacagtgaaggccaaaaatttc
cgtggccagtgttcagctactgcttccttaacagtccttcctctagttgaagaacctccc
agagaggtagtattgaggacaagtggtgacacaagcttgcaaggaagcttctcgtctcag
tcagtccaaatgtctgcctctaagcaggaggcctccttcagcagtttcagcagcagcagt
gctagcagcatgactgaaatgaaatttgcaagcatgtctgcccaaagcatgtcctccatg
caagagtcctttgtagaaatgagttccagcagttttatgggaaaatctagtaggacacaa
ctggaaagctcaactagtagaatgcttaaagcaggcataagaggaattccacctaaaatt
gaagctcttccctctgacatcagcatcgatgagggcaaagttctaacagtagcctgtgct
tttacgggggagcctaccccggagataacatggtcccgtgctggaagaaaaattcaaaac
caagaacaacacgggagattccacattgaaaacacagatgacctgacaactctgatcatc
atggacgtacagaaacaagatggtggactttataccctgagtttagggaatgaatttggg
tctgactctgccactgtgaacataaacattagatccatttaa

DBGET integrated database retrieval system